PDB entry 4l9h

View 4l9h on RCSB PDB site
Description: Crystal structure of the FP domain of human F-box protein Fbxo7(SeMet)
Deposited on 2013-06-18, released 2014-01-15
The last revision was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F-box only protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: FBX7, FBXO7, HUMAN FBXO7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y3I1 (4-End)
      • expression tag (0-3)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4l9hA (A:)
gpssphsletlyqsadcsdandalivlihllmlesgyipqgteakalsmpekwklsgvyk
lqymhplcegssatltcvplgnlivvnatlkinneirsvkrlqllpesfickeklgenva
niykdlqklsrlfkdqlvypllaftrqalnlpdvfglvvl

    Sequence, based on observed residues (ATOM records):
    >4l9hA (A:)
gpssphsletlyqsadcsdandalivlihllmlesgyipqgteakalsmpekwklsgvyk
lqymhplcegssatltcvplgnlivvnatlkinneirsvkrlqllpesfickeklgenva
niykdlqklsrlfkdqlvypllaftrqalnlpdvf