PDB entry 4l9f

View 4l9f on RCSB PDB site
Description: Structure of a SeMet derivative of PpsR Q-PAS1 from Rb. sphaeroides
Deposited on 2013-06-18, released 2014-02-12
The last revision was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.195
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, PpsR
    Species: Rhodobacter sphaeroides [TaxId:272943]
    Gene: ppsR, RHOS4_18870, RSP_0282
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4l9fA (A:)
gamgiaevqqqlvaaqlamerdyetqremetryrvvldvsrdpmvlvsmstgrivdlnsa
aglllggvrqdllgaaiaqefegrrrgefmetmtnlaatesaapvevlarrsqkrllvvp
rvfraagerlllcqidpad

    Sequence, based on observed residues (ATOM records):
    >4l9fA (A:)
tqremetryrvvldvsrdpmvlvsmstgrivdlnsaaglllggvrqdllgaaiaqefegr
rrgefmetmtnlaatpvevlarrsqkrllvvprvfraagerlllcqidpad