PDB entry 4l95

View 4l95 on RCSB PDB site
Description: Crystal structure of gamma glutamyl hydrolase (H218N) from zebrafish
Class: Hydrolase
Keywords: Sandwiched-like domain, Hydrolase
Deposited on 2013-06-18, released 2014-05-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.243
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: gamma-glutamyl hydrolase
    Species: Danio rerio [TaxId:7955]
    Gene: ggh
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NY42 (Start-311)
      • engineered mutation (238)
    Domains in SCOPe 2.07: d4l95c_
  • Chain 'E':
    Compound: gamma-glutamyl hydrolase
    Species: Danio rerio [TaxId:7955]
    Gene: ggh
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NY42 (Start-311)
      • engineered mutation (238)
    Domains in SCOPe 2.07: d4l95e_
  • Chain 'F':
    Compound: gamma-glutamyl hydrolase
    Species: Danio rerio [TaxId:7955]
    Gene: ggh
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NY42 (Start-311)
      • engineered mutation (238)
    Domains in SCOPe 2.07: d4l95f_
  • Chain 'G':
    Compound: gamma-glutamyl hydrolase
    Species: Danio rerio [TaxId:7955]
    Gene: ggh
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NY42 (Start-311)
      • engineered mutation (238)
    Domains in SCOPe 2.07: d4l95g_
  • Chain 'K':
    Compound: gamma-glutamyl hydrolase
    Species: Danio rerio [TaxId:7955]
    Gene: ggh
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NY42 (Start-311)
      • engineered mutation (238)
    Domains in SCOPe 2.07: d4l95k_
  • Chain 'M':
    Compound: gamma-glutamyl hydrolase
    Species: Danio rerio [TaxId:7955]
    Gene: ggh
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NY42 (Start-311)
      • engineered mutation (238)
    Domains in SCOPe 2.07: d4l95m_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4l95C (C:)
    mihifllclftvanavsiynfgpliktnerpiigvlaqdvfdpkpdrnsyiaasyvkfle
    sagarvvpvminksedeysrlfksingvlfpgggvslessgyskaagifyrlaleansng
    dyfpvwgtclgfelltlltsgelllshtntsgialpldftedvkgsrlfkefpeelmksl
    atepltenshqwsittenftankklkkfyrvlstntdgynkfvstmeaydfpiyatqwnp
    eknafewtrpyiphtpsaikttfymanffvnearknlhsfasteeeekaliynykpeytg
    iqsafeqtyffn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l95C (C:)
    ktnerpiigvlaqdvfdpkpdrnsyiaasyvkflesagarvvpvminksedeysrlfksi
    ngvlfpgggvslessgyskaagifyrlaleansngdyfpvwgtclgfelltlltsgelll
    shtntsgialpldftedvkgsrlfkefpeelmkslatepltenshqwsittenftankkl
    kkfyrvlstntdgynkfvstmeaydfpiyatqwnpeknafewtrpyiphtpsaikttfym
    anffvnearknlhsfasteeeekaliynykpeytgiqsafeqtyffn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4l95E (E:)
    mihifllclftvanavsiynfgpliktnerpiigvlaqdvfdpkpdrnsyiaasyvkfle
    sagarvvpvminksedeysrlfksingvlfpgggvslessgyskaagifyrlaleansng
    dyfpvwgtclgfelltlltsgelllshtntsgialpldftedvkgsrlfkefpeelmksl
    atepltenshqwsittenftankklkkfyrvlstntdgynkfvstmeaydfpiyatqwnp
    eknafewtrpyiphtpsaikttfymanffvnearknlhsfasteeeekaliynykpeytg
    iqsafeqtyffn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l95E (E:)
    ktnerpiigvlaqdvfdpkpdrnsyiaasyvkflesagarvvpvminksedeysrlfksi
    ngvlfpgggvslessgyskaagifyrlaleansngdyfpvwgtclgfelltlltsgelll
    shtntsgialpldftedvkgsrlfkefpeelmkslatepltenshqwsittenftankkl
    kkfyrvlstntdgynkfvstmeaydfpiyatqwnpeknafewtrpyiphtpsaikttfym
    anffvnearknlhsfasteeeekaliynykpeytgiqsafeqtyffn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4l95F (F:)
    mihifllclftvanavsiynfgpliktnerpiigvlaqdvfdpkpdrnsyiaasyvkfle
    sagarvvpvminksedeysrlfksingvlfpgggvslessgyskaagifyrlaleansng
    dyfpvwgtclgfelltlltsgelllshtntsgialpldftedvkgsrlfkefpeelmksl
    atepltenshqwsittenftankklkkfyrvlstntdgynkfvstmeaydfpiyatqwnp
    eknafewtrpyiphtpsaikttfymanffvnearknlhsfasteeeekaliynykpeytg
    iqsafeqtyffn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l95F (F:)
    ktnerpiigvlaqdvfdpkpdrnsyiaasyvkflesagarvvpvminksedeysrlfksi
    ngvlfpgggvslessgyskaagifyrlaleansngdyfpvwgtclgfelltlltsgelll
    shtntsgialpldftedvkgsrlfkefpeelmkslatepltenshqwsittenftankkl
    kkfyrvlstntdgynkfvstmeaydfpiyatqwnpeknafewtrpyiphtpsaikttfym
    anffvnearknlhsfasteeeekaliynykpeytgiqsafeqtyffn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4l95G (G:)
    mihifllclftvanavsiynfgpliktnerpiigvlaqdvfdpkpdrnsyiaasyvkfle
    sagarvvpvminksedeysrlfksingvlfpgggvslessgyskaagifyrlaleansng
    dyfpvwgtclgfelltlltsgelllshtntsgialpldftedvkgsrlfkefpeelmksl
    atepltenshqwsittenftankklkkfyrvlstntdgynkfvstmeaydfpiyatqwnp
    eknafewtrpyiphtpsaikttfymanffvnearknlhsfasteeeekaliynykpeytg
    iqsafeqtyffn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l95G (G:)
    ktnerpiigvlaqdvfdpkpdrnsyiaasyvkflesagarvvpvminksedeysrlfksi
    ngvlfpgggvslessgyskaagifyrlaleansngdyfpvwgtclgfelltlltsgelll
    shtntsgialpldftedvkgsrlfkefpeelmkslatepltenshqwsittenftankkl
    kkfyrvlstntdgynkfvstmeaydfpiyatqwnpeknafewtrpyiphtpsaikttfym
    anffvnearknlhsfasteeeekaliynykpeytgiqsafeqtyffn
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4l95K (K:)
    mihifllclftvanavsiynfgpliktnerpiigvlaqdvfdpkpdrnsyiaasyvkfle
    sagarvvpvminksedeysrlfksingvlfpgggvslessgyskaagifyrlaleansng
    dyfpvwgtclgfelltlltsgelllshtntsgialpldftedvkgsrlfkefpeelmksl
    atepltenshqwsittenftankklkkfyrvlstntdgynkfvstmeaydfpiyatqwnp
    eknafewtrpyiphtpsaikttfymanffvnearknlhsfasteeeekaliynykpeytg
    iqsafeqtyffn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l95K (K:)
    ktnerpiigvlaqdvfdpkpdrnsyiaasyvkflesagarvvpvminksedeysrlfksi
    ngvlfpgggvslessgyskaagifyrlaleansngdyfpvwgtclgfelltlltsgelll
    shtntsgialpldftedvkgsrlfkefpeelmkslatepltenshqwsittenftankkl
    kkfyrvlstntdgynkfvstmeaydfpiyatqwnpeknafewtrpyiphtpsaikttfym
    anffvnearknlhsfasteeeekaliynykpeytgiqsafeqtyffn
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4l95M (M:)
    mihifllclftvanavsiynfgpliktnerpiigvlaqdvfdpkpdrnsyiaasyvkfle
    sagarvvpvminksedeysrlfksingvlfpgggvslessgyskaagifyrlaleansng
    dyfpvwgtclgfelltlltsgelllshtntsgialpldftedvkgsrlfkefpeelmksl
    atepltenshqwsittenftankklkkfyrvlstntdgynkfvstmeaydfpiyatqwnp
    eknafewtrpyiphtpsaikttfymanffvnearknlhsfasteeeekaliynykpeytg
    iqsafeqtyffn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l95M (M:)
    ktnerpiigvlaqdvfdpkpdrnsyiaasyvkflesagarvvpvminksedeysrlfksi
    ngvlfpgggvslessgyskaagifyrlaleansngdyfpvwgtclgfelltlltsgelll
    shtntsgialpldftedvkgsrlfkefpeelmkslatepltenshqwsittenftankkl
    kkfyrvlstntdgynkfvstmeaydfpiyatqwnpeknafewtrpyiphtpsaikttfym
    anffvnearknlhsfasteeeekaliynykpeytgiqsafeqtyffn