PDB entry 4l8y

View 4l8y on RCSB PDB site
Description: Crystal structure of gamma-glutamyl hydrolase (C108A) from zebrafish
Class: Hydrolase
Keywords: Sandwiched-like domain, Hydrolase
Deposited on 2013-06-18, released 2014-05-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.202
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gamma-glutamyl hydrolase
    Species: Danio rerio [TaxId:7955]
    Gene: ggh
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NY42 (Start-311)
      • engineered mutation (128)
    Domains in SCOPe 2.07: d4l8ya_
  • Chain 'B':
    Compound: gamma-glutamyl hydrolase
    Species: Danio rerio [TaxId:7955]
    Gene: ggh
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NY42 (Start-311)
      • engineered mutation (128)
    Domains in SCOPe 2.07: d4l8yb_
  • Chain 'C':
    Compound: gamma-glutamyl hydrolase
    Species: Danio rerio [TaxId:7955]
    Gene: ggh
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NY42 (Start-311)
      • engineered mutation (128)
    Domains in SCOPe 2.07: d4l8yc_
  • Chain 'D':
    Compound: gamma-glutamyl hydrolase
    Species: Danio rerio [TaxId:7955]
    Gene: ggh
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NY42 (Start-311)
      • engineered mutation (128)
    Domains in SCOPe 2.07: d4l8yd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l8yA (A:)
    mihifllclftvanavsiynfgpliktnerpiigvlaqdvfdpkpdrnsyiaasyvkfle
    sagarvvpvminksedeysrlfksingvlfpgggvslessgyskaagifyrlaleansng
    dyfpvwgtalgfelltlltsgelllshtntsgialpldftedvkgsrlfkefpeelmksl
    atepltenshqwsittenftankklkkfyrvlstntdgynkfvstmeaydfpiyatqwhp
    eknafewtrpyiphtpsaikttfymanffvnearknlhsfasteeeekaliynykpeytg
    iqsafeqtyffn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l8yA (A:)
    ktnerpiigvlaqdvfdpkpdrnsyiaasyvkflesagarvvpvminksedeysrlfksi
    ngvlfpgggvslessgyskaagifyrlaleansngdyfpvwgtalgfelltlltsgelll
    shtntsgialpldftedvkgsrlfkefpeelmkslatepltenshqwsittenftankkl
    kkfyrvlstntdgynkfvstmeaydfpiyatqwhpeknafewtrpyiphtpsaikttfym
    anffvnearknlhsfasteeeekaliynykpeytgiqsafeqtyffn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4l8yB (B:)
    mihifllclftvanavsiynfgpliktnerpiigvlaqdvfdpkpdrnsyiaasyvkfle
    sagarvvpvminksedeysrlfksingvlfpgggvslessgyskaagifyrlaleansng
    dyfpvwgtalgfelltlltsgelllshtntsgialpldftedvkgsrlfkefpeelmksl
    atepltenshqwsittenftankklkkfyrvlstntdgynkfvstmeaydfpiyatqwhp
    eknafewtrpyiphtpsaikttfymanffvnearknlhsfasteeeekaliynykpeytg
    iqsafeqtyffn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l8yB (B:)
    ktnerpiigvlaqdvfdpkpdrnsyiaasyvkflesagarvvpvminksedeysrlfksi
    ngvlfpgggvslessgyskaagifyrlaleansngdyfpvwgtalgfelltlltsgelll
    shtntsgialpldftedvkgsrlfkefpeelmkslatepltenshqwsittenftankkl
    kkfyrvlstntdgynkfvstmeaydfpiyatqwhpeknafewtrpyiphtpsaikttfym
    anffvnearknlhsfasteeeekaliynykpeytgiqsafeqtyffn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4l8yC (C:)
    mihifllclftvanavsiynfgpliktnerpiigvlaqdvfdpkpdrnsyiaasyvkfle
    sagarvvpvminksedeysrlfksingvlfpgggvslessgyskaagifyrlaleansng
    dyfpvwgtalgfelltlltsgelllshtntsgialpldftedvkgsrlfkefpeelmksl
    atepltenshqwsittenftankklkkfyrvlstntdgynkfvstmeaydfpiyatqwhp
    eknafewtrpyiphtpsaikttfymanffvnearknlhsfasteeeekaliynykpeytg
    iqsafeqtyffn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l8yC (C:)
    ktnerpiigvlaqdvfdpkpdrnsyiaasyvkflesagarvvpvminksedeysrlfksi
    ngvlfpgggvslessgyskaagifyrlaleansngdyfpvwgtalgfelltlltsgelll
    shtntsgialpldftedvkgsrlfkefpeelmkslatepltenshqwsittenftankkl
    kkfyrvlstntdgynkfvstmeaydfpiyatqwhpeknafewtrpyiphtpsaikttfym
    anffvnearknlhsfasteeeekaliynykpeytgiqsafeqtyffn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4l8yD (D:)
    mihifllclftvanavsiynfgpliktnerpiigvlaqdvfdpkpdrnsyiaasyvkfle
    sagarvvpvminksedeysrlfksingvlfpgggvslessgyskaagifyrlaleansng
    dyfpvwgtalgfelltlltsgelllshtntsgialpldftedvkgsrlfkefpeelmksl
    atepltenshqwsittenftankklkkfyrvlstntdgynkfvstmeaydfpiyatqwhp
    eknafewtrpyiphtpsaikttfymanffvnearknlhsfasteeeekaliynykpeytg
    iqsafeqtyffn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l8yD (D:)
    ktnerpiigvlaqdvfdpkpdrnsyiaasyvkflesagarvvpvminksedeysrlfksi
    ngvlfpgggvslessgyskaagifyrlaleansngdyfpvwgtalgfelltlltsgelll
    shtntsgialpldftedvkgsrlfkefpeelmkslatepltenshqwsittenftankkl
    kkfyrvlstntdgynkfvstmeaydfpiyatqwhpeknafewtrpyiphtpsaikttfym
    anffvnearknlhsfasteeeekaliynykpeytgiqsafeqtyffn