PDB entry 4l8m

View 4l8m on RCSB PDB site
Description: Human p38 MAP kinase in complex with a Dibenzoxepinone
Class: transferase/transferase inhibitor
Keywords: protein kinase, selective p38 inhibitor, SAR, Dibenzoxepinone derivative, Dibenzoxepinone, transferase-transferase inhibitor complex
Deposited on 2013-06-17, released 2013-10-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.223
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4l8ma_
  • Heterogens: BOG, F46, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l8mA (A:)
    gsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l8mA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkkltddh
    vqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtvatrwyrapei
    mlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkisse
    sarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhd
    pddepvadpydqsfesrdllidewksltydevisfvppp