PDB entry 4l8l

View 4l8l on RCSB PDB site
Description: Crystal Structure of the Type II Dehydroquinase from Pseudomonas aeruginosa
Deposited on 2013-06-17, released 2014-07-23
The last revision was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.163
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase 1
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: aroQ, aroQ1, PA4846
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30557 (2-144)
      • expression tag (0-1)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4l8lA (A:)
qgtllvlhgpnlnllgtrepgtygsttlgqinqdlerrareaghhllhlqsnaeyelidr
ihaardegvdfiiinpaafthtsvalrdallavsipfievhlsnvhkrepfrhhsyfsdv
avgvicglgatgyrlalesaleqlq

    Sequence, based on observed residues (ATOM records):
    >4l8lA (A:)
qgtllvlhgpnlnllgtsttlgqinqdlerrareaghhllhlqsnaeyelidrihaarde
gvdfiiinpaafthtsvalrdallavsipfievhlsnvhkrepfrhhsyfsdvavgvicg
lgatgyrlalesaleqlq