PDB entry 4l8a

View 4l8a on RCSB PDB site
Description: Crystal structure of a GNAT superfamily acetyltransferase PA4794 in ternary complex with N-Phenylacetyl-Gly-AcLys and CoA
Class: transferase
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, GNAT, acetyltransferase, TRANSFERASE
Deposited on 2013-06-16, released 2013-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.13
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA4794
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4l8aa_
  • Heterogens: EDO, COA, SO4, 1VP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l8aA (A:)
    ghmqlshrpaetgdletvagfpqdrdelfycypkaiwpfsvaqlaaaiaerrgstvavhd
    gqvlgfanfyqwqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkiscf
    nanaaglllytqlgyqpraiaerhdpdgrrvaliqmdkplep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l8aA (A:)
    mqlshrpaetgdletvagfpqdrdelfycypkaiwpfsvaqlaaaiaerrgstvavhdgq
    vlgfanfyqwqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkiscfna
    naaglllytqlgyqpraiaerhdpdgrrvaliqmdkple