PDB entry 4l83

View 4l83 on RCSB PDB site
Description: Structure of a putative Ubiquitin-conjugating enzyme E2 from Brugia malayi
Class: ligase
Keywords: Ubiquitin, SSGCID, Seattle Structural Genomics Center for Infectious Disease, NIAID, National Institute of Allergy and Infectious Diseases, Ubiquitin-conjugating enzyme, LIGASE
Deposited on 2013-06-15, released 2013-06-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.172
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ube2i2 protein
    Species: Brugia malayi [TaxId:6279]
    Gene: Bm1_40505
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4l83a_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4l83A (A:)
mahhhhhhmsgiaagrlaeerkawrknhpfgfiakpssnpdgtrnlfiwecaipgkkgti
wegglykirmqfkddypstppkckfdpplfhpnvypsgtvclsildenkdwkpsisvrql
ligiqdlltnpnvddpaqadayqiycqnrveyekrvrrqaqqfsaeivqrqmldn

    Sequence, based on observed residues (ATOM records): (download) 
    >4l83A (A:)
giaagrlaeerkawrknhpfgfiakpssnpdgtrnlfiwecaipgkkgtiwegglykirm
qfkddypstppkckfdpplfhpnvypsgtvclsildenkdwkpsisvrqlligiqdlltn
pnvddpaqadayqiycqnrveyekrvrrqaqqfsaeivqrqmldn