PDB entry 4l7x

View 4l7x on RCSB PDB site
Description: Crystal structure of the DIDO PHD finger in complex with H3K4me3
Deposited on 2013-06-14, released 2013-07-24
The last revision was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.133
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death-inducer obliterator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DIDO1, C20orf158, DATF1, KIAA0333
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BTC0 (3-End)
      • expression tag (0-2)
  • Chain 'U':
    Compound: histone h3 peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4L7X (0-End)
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4l7xA (A:)
gplpnalycicrqphnnrfmiccdrceewfhgdcvgiseargrllerngedyicpnctil
qvq

    Sequence, based on observed residues (ATOM records):
    >4l7xA (A:)
gplpnalycicrqphnnrfmiccdrceewfhgdcvgiseargrllerngedyicpnct

  • Chain 'U':
    Sequence, based on SEQRES records:
    >4l7xU (U:)
artkqtarkstg

    Sequence, based on observed residues (ATOM records):
    >4l7xU (U:)
artkqta