PDB entry 4l7f

View 4l7f on RCSB PDB site
Description: Co-crystal Structure of JNK1 and AX13587
Class: Transferase/Transferase Inhibitor
Keywords: protein kinase fold, protein kinase, jun-c, phosphorylation, Transferase-Transferase Inhibitor complex
Deposited on 2013-06-13, released 2013-08-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.162
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 8
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK8, JNK1, PRKM8, SAPK1, SAPK1C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45983 (2-357)
      • expression tag (0-1)
      • expression tag (358-366)
    Domains in SCOPe 2.04: d4l7fa_
  • Heterogens: 1V5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l7fA (A:)
    sldnnfysveigdstftvlkryqnlkpigsgaqgivcaaydailernvaikklsrpfqnq
    thakrayrelvlmkcvnhkniigllnvftpqksleefqdvyivmelmdanlcqviqmeld
    hermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmmtp
    yvvtryyrapevilgmgykenvdlwsvgcimgemvchkilfpgrdyidqwnkvieqlgtp
    cpefmkklqptvrtyvenrpkyagysfeklfpdvlfpadsehnklkasqardllskmlvi
    daskrisvdealqhpyinvwydpseaeapppkipdkqlderehtieewkeliykevmdwr
    kgiitit
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l7fA (A:)
    sldnnfysveigdstftvlkryqnlkpigsgaqgivcaaydailernvaikklsrpfqnq
    thakrayrelvlmkcvnhkniigllnvftpqksleefqdvyivmelmdanlcqviqmeld
    hermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglvvtryyrapevi
    lgmgykenvdlwsvgcimgemvchkilfpgrdyidqwnkvieqlgtpcpefmkklqptvr
    tyvenrpkyagysfeklfpdvlfpadsehnklkasqardllskmlvidaskrisvdealq
    hpyinvwydpseaeapppkipdkqlderehtieewkeliykevmdwrkgiitit