PDB entry 4l78

View 4l78 on RCSB PDB site
Description: Xenon Trapping and Statistical Coupling Analysis Uncover Regions Important for Structure and Function of Multidomain Protein StPurL
Deposited on 2013-06-13, released 2013-12-11
The last revision was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.14
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosylformylglycinamidine synthase
    Species: Salmonella typhimurium [TaxId:99287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74881 (8-1302)
      • expression tag (0-7)
      • engineered mutation (1270)
  • Heterogens: ADP, MG, MN, SO4, XE, CL, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4l78A (A:)
    glvprgshmmeilrgspalsafrinkllarfqaanlqvhniyaeyvhfadlnaplndseq
    aqltrllqygpalsshtpagklllvtprpgtispwsskatdiahncglqqvdrlergvay
    yieastltaeqwrqvaaelhdrmmetvfssltdaeklfihhqpapvssvdllgegrqali
    danlrlglalaedeidylqeaftklgrnpndielymfaqansehcrhkifnadwiidgkp
    qpkslfkmikntfettpdyvlsaykdnaavmegsavgryfadhntgrydfhqepahilmk
    vethnhptaispwpgaatgsggeirdegatgrgakpkaglvgfsvsnlripgfeqpweed
    fgkperivtaldimtegplggaafnnefgrpaltgyfrtyeekvnshngeelrgyhkpim
    laggigniradhvqkgeivvgaklivlggpamniglgggaassmasgqsdadldfasvqr
    dnpemerrcqevidrcwqlgdanpilfihdvgagglsnampelvsdggrggkfelrdils
    depgmspleiwcnesqeryvlavaadqlplfdelckrerapyavigdateeqhlslhdnh
    fdnqpidlpldvllgktpkmtrdvqtlkakgdalnraditiadavkrvlhlptvaektfl
    vtigdrtvtgmvardqmvgpwqvpvadcavttasldsyygeamsigerapvalldfaasa
    rlavgealtniaatqigdikriklsanwmaaaghpgedaglydavkavgeelcpqlglti
    pvgkdsmsmktrwqegneqremtsplslvisafarvedvrhtltpqlstednalllidlg
    kghnalgatalaqvyrqlgdkpadvrdvaqlkgfydamqalvaarkllawhdrsdggllv
    tlaemafaghcgvqvdiaalgddhlaalfneelggviqvraedrdaveallaqygladcv
    hylgqalagdrfvitandqtvfsesrttlrvwwaettwqmqrlrdnpqcadqeheakand
    tdpglnvklsfdinediaapyiatgarpkvavlreqgvnshvemaaafhragfdaidvhm
    sdllggriglgnfhalvacggfsygdvlgagegwaksilfnhrvrdefetffhrpqtlal
    gvcngcqmmsnlrelipgselwprfvrnhsdrfearfslvevtqspslllqgmvgsqmpi
    avshgegrvevrddahlaaleskglvalryvdnfgkvtetypanpngspngitavtteng
    rvtimmphpeavfrtvanswhpenwgedspwmrifrnarkqlg
    

    Sequence, based on observed residues (ATOM records):
    >4l78A (A:)
    glvprgshmmeilrgspalsafrinkllarfqaanlqvhniyaeyvhfadlnaplndseq
    aqltrllqygpalsshtpagklllvtprpgtispwsskatdiahncglqqvdrlergvay
    yieastltaeqwrqvaaelhdrmmetvfssltdaeklfihhqpapvssvdllgegrqali
    danlrlglalaedeidylqeaftklgrnpndielymfaqansehcrhkifnadwiidgkp
    qpkslfkmikntfettpdyvlsaykdnaavmegsavgryfadhntgrydfhqepahilmk
    vethnhptaispwpgaatgsggeirdegatgrgakpkaglvgfsvsnlripgfeqpweed
    fgkperivtaldimtegplggaafnnefgrpaltgyfrtyeekvnshngeelrgyhkpim
    laggigniradhvqkgeivvgaklivlggpamnigdfasvqrdnpemerrcqevidrcwq
    lgdanpilfihdvgagglsnampelvsdggrggkfelrdilsdepgmspleiwcnesqer
    yvlavaadqlplfdelckrerapyavigdateeqhlslhdnhfdnqpidlpldvllgktp
    kmtrdvqtlkakgdalnraditiadavkrvlhlptvaektflvtigdrtvtgmvardqmv
    gpwqvpvadcavttasldsyygeamsigerapvalldfaasarlavgealtniaatqigd
    ikriklsanwmaaaghpgedaglydavkavgeelcpqlgltipvgkdsmsmktrwqegne
    qremtsplslvisafarvedvrhtltpqlstednalllidlgkghnalgatalaqvyrql
    gdkpadvrdvaqlkgfydamqalvaarkllawhdrsdggllvtlaemafaghcgvqvdia
    algddhlaalfneelggviqvraedrdaveallaqygladcvhylgqalagdrfvitand
    qtvfsesrttlrvwwaettwqmqrlrdnpqcadqeheakandtdpglnvklsfdinedia
    apyiatgarpkvavlreqgvnshvemaaafhragfdaidvhmsdllggriglgnfhalva
    cggfsygdvlgagegwaksilfnhrvrdefetffhrpqtlalgvcngcqmmsnlrelipg
    selwprfvrnhsdrfearfslvevtqspslllqgmvgsqmpiavshgegrvevrddahla
    aleskglvalryvdnfgkvtetypanpngspngitavttengrvtimmphpeavfrtvan
    swhpenwgedspwmrifrnarkqlg