PDB entry 4l6e

View 4l6e on RCSB PDB site
Description: Crystal Structure of the RanBD1 fourth domain of E3 SUMO-protein ligase RanBP2. Northeast Structural Genomics Consortium (NESG) Target HR9193b
Class: ligase, isomerase
Keywords: Structural Genomics, PSI-Biology, Protein Structure Initiative, NESG, RanBP2, RanBD1, Northeast Structural Genomics Consortium, LIGASE, ISOMERASE
Deposited on 2013-06-12, released 2013-06-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 SUMO-protein ligase RanBP2
    Species: Homo sapiens [TaxId:9606]
    Gene: NUP358, RANBP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4l6ea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l6eA (A:)
    mghhhhhhshmnedihfepivslpevevksgeedeeilfkeraklyrwdrdvsqwkergv
    gdikilwhtmknyyrilmrrdqvfkvcanhvitktmelkplnvsnnalvwtasdyadgea
    kveqlavrfktkevadcfkktfeecqqnlmklqkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l6eA (A:)
    sgeedeeilfkeraklyrwdrdvsqwkergvgdikilwhtmknyyrilmrrdqvfkvcan
    hvitktmelkplnvsnnalvwtasdyadgeakveqlavrfktkevadcfkktfeecqqnl
    mklq