PDB entry 4l63

View 4l63 on RCSB PDB site
Description: Apo form of AB5 holotoxin
Class: hydrolase
Keywords: matrix metalloprotease, ab5 toxin, ob fold, cholera-like toxin, pentamer, toxin, protease, gm1, toxilysin, hydrolase
Deposited on 2013-06-11, released 2013-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ecxa
    Species: Escherichia coli [TaxId:562]
    Gene: ecxA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ecxb
    Species: Escherichia coli [TaxId:562]
    Gene: ecxB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GAV3 (1-103)
      • initiating methionine (0)
      • expression tag (104)
    Domains in SCOPe 2.07: d4l63b1, d4l63b2
  • Chain 'C':
    Compound: ecxb
    Species: Escherichia coli [TaxId:562]
    Gene: ecxB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GAV3 (1-103)
      • initiating methionine (0)
      • expression tag (104)
    Domains in SCOPe 2.07: d4l63c1, d4l63c2
  • Chain 'D':
    Compound: ecxb
    Species: Escherichia coli [TaxId:562]
    Gene: ecxB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GAV3 (1-103)
      • initiating methionine (0)
      • expression tag (104)
    Domains in SCOPe 2.07: d4l63d1, d4l63d2
  • Chain 'E':
    Compound: ecxb
    Species: Escherichia coli [TaxId:562]
    Gene: ecxB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GAV3 (1-103)
      • expression tag (104)
    Domains in SCOPe 2.07: d4l63e1, d4l63e2
  • Chain 'F':
    Compound: ecxb
    Species: Escherichia coli [TaxId:562]
    Gene: ecxB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4l63f_
  • Heterogens: ZN, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4l63B (B:)
    mtpqnitdlcneyqntmiyslnkeiatyteslagkremviisfsngatfqvevpgsqhle
    sqkrplermkdtlraayftgikisklcawtnkspnsiaaielsnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l63B (B:)
    mtpqnitdlcneyqntmiyslnkeiatyteslagkremviisfsngatfqvevpgsqhle
    sqkrplermkdtlraayftgikisklcawtnkspnsiaaielsnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4l63C (C:)
    mtpqnitdlcneyqntmiyslnkeiatyteslagkremviisfsngatfqvevpgsqhle
    sqkrplermkdtlraayftgikisklcawtnkspnsiaaielsnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l63C (C:)
    mtpqnitdlcneyqntmiyslnkeiatyteslagkremviisfsngatfqvevpgsqhle
    sqkrplermkdtlraayftgikisklcawtnkspnsiaaielsnl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4l63D (D:)
    mtpqnitdlcneyqntmiyslnkeiatyteslagkremviisfsngatfqvevpgsqhle
    sqkrplermkdtlraayftgikisklcawtnkspnsiaaielsnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l63D (D:)
    mtpqnitdlcneyqntmiyslnkeiatyteslagkremviisfsngatfqvevpgsqhle
    sqkrplermkdtlraayftgikisklcawtnkspnsiaaielsnl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4l63E (E:)
    mtpqnitdlcneyqntmiyslnkeiatyteslagkremviisfsngatfqvevpgsqhle
    sqkrplermkdtlraayftgikisklcawtnkspnsiaaielsnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l63E (E:)
    tpqnitdlcneyqntmiyslnkeiatyteslagkremviisfsngatfqvevpgsqhles
    qkrplermkdtlraayftgikisklcawtnkspnsiaaielsnl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4l63F (F:)
    mtpqnitdlcneyqntmiyslnkeiatyteslagkremviisfsngatfqvevpgsqhle
    sqkrplermkdtlraayftgikisklcawtnkspnsiaaielsnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l63F (F:)
    tpqnitdlcneyqntmiyslnkeiatyteslagkremviisfsngatfqvevpgsqhles
    qkrplermkdtlraayftgikisklcawtnkspnsiaaielsn