PDB entry 4l62

View 4l62 on RCSB PDB site
Description: Crystal Structure of Pseudomonas aeruginosa transcriptional regulator PA2196 bound to its operator DNA
Deposited on 2013-06-11, released 2013-10-23
The last revision was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.2
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA2196
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transcriptional regulator
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA2196
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Transcriptional regulator
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA2196
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Transcriptional regulator
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA2196
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Transcriptional regulator
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA2196
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Transcriptional regulator
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA2196
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Transcriptional regulator
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA2196
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Transcriptional regulator
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA2196
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Transcriptional regulator
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA2196
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Transcriptional regulator
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA2196
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Transcriptional regulator
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA2196
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Transcriptional regulator
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA2196
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Transcriptional regulator
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA2196
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Transcriptional regulator
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA2196
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Transcriptional regulator
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA2196
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Transcriptional regulator
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA2196
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: DNA (25-mer)
  • Chain 'R':
    Compound: DNA (25-mer)
  • Chain 'S':
    Compound: DNA (25-mer)
  • Chain 'T':
    Compound: DNA (25-mer)
  • Chain 'U':
    Compound: DNA (25-mer)
  • Chain 'V':
    Compound: DNA (25-mer)
  • Chain 'W':
    Compound: DNA (25-mer)
  • Chain 'X':
    Compound: DNA (25-mer)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4l62A (A:)
    syddtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyf
    rvyladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmri
    tlrdgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgplet
    amqttrslle
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4l62B (B:)
    syddtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyf
    rvyladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmri
    tlrdgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgplet
    amqttrslle
    

    Sequence, based on observed residues (ATOM records):
    >4l62B (B:)
    dtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyfrvy
    ladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmritlr
    dgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgpletamq
    ttrslle
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >4l62C (C:)
    syddtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyf
    rvyladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmri
    tlrdgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgplet
    amqttrslle
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >4l62D (D:)
    syddtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyf
    rvyladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmri
    tlrdgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgplet
    amqttrslle
    

    Sequence, based on observed residues (ATOM records):
    >4l62D (D:)
    dtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyfrvy
    ladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmritlr
    dgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgpletamq
    ttrslle
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >4l62E (E:)
    syddtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyf
    rvyladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmri
    tlrdgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgplet
    amqttrslle
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >4l62F (F:)
    syddtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyf
    rvyladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmri
    tlrdgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgplet
    amqttrslle
    

    Sequence, based on observed residues (ATOM records):
    >4l62F (F:)
    dtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyfrvy
    ladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmritlr
    dgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgpletamq
    ttrslle
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >4l62G (G:)
    syddtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyf
    rvyladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmri
    tlrdgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgplet
    amqttrslle
    

    Sequence, based on observed residues (ATOM records):
    >4l62G (G:)
    dtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyfrvy
    ladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmritlr
    dgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgpletamq
    ttrslle
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >4l62H (H:)
    syddtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyf
    rvyladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmri
    tlrdgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgplet
    amqttrslle
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >4l62I (I:)
    syddtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyf
    rvyladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmri
    tlrdgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgplet
    amqttrslle
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >4l62J (J:)
    syddtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyf
    rvyladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmri
    tlrdgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgplet
    amqttrslle
    

    Sequence, based on observed residues (ATOM records):
    >4l62J (J:)
    dtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyfrvy
    ladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmritlr
    dgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgpletamq
    ttrslle
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >4l62K (K:)
    syddtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyf
    rvyladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmri
    tlrdgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgplet
    amqttrslle
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >4l62L (L:)
    syddtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyf
    rvyladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmri
    tlrdgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgplet
    amqttrslle
    

    Sequence, based on observed residues (ATOM records):
    >4l62L (L:)
    dtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyfrvy
    ladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmritlr
    dgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgpletamq
    ttrslle
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records:
    >4l62M (M:)
    syddtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyf
    rvyladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmri
    tlrdgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgplet
    amqttrslle
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >4l62N (N:)
    syddtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyf
    rvyladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmri
    tlrdgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgplet
    amqttrslle
    

    Sequence, based on observed residues (ATOM records):
    >4l62N (N:)
    dtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyfrvy
    ladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmritlr
    dgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgpletamq
    ttrslle
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records:
    >4l62O (O:)
    syddtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyf
    rvyladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmri
    tlrdgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgplet
    amqttrslle
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >4l62P (P:)
    syddtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyf
    rvyladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmri
    tlrdgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgplet
    amqttrslle
    

    Sequence, based on observed residues (ATOM records):
    >4l62P (P:)
    dtrqhlldtgyrimavkgfsgvglneilqsagvpkgsfyhyfkskeqfgqalledyfrvy
    ladmdqrfsapglnarerlmsywqkwldnacppcdeqrclvvklsaevadlsesmritlr
    dgsdgiierlvgclgqgrddgslapcdarhmasalyqlwlgasllsklhrspgpletamq
    ttrslle
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.