PDB entry 4l60

View 4l60 on RCSB PDB site
Description: Structure of C81R Mutant PCNA Protein Defective in Mismatch Repair
Class: DNA binding protein
Keywords: DNA mismatch repair, DNA replication, Translesion synthesis, Nucleus, DNA BINDING PROTEIN
Deposited on 2013-06-11, released 2013-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-11-05, with a file datestamp of 2014-10-31.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.201
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: POL30, YBR0811, YBR088C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15873 (0-255)
      • engineered mutation (80)
    Domains in SCOPe 2.08: d4l60a1, d4l60a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4l60A (A:)
mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
rcdhpvtlgmdltslskilrrgnntdtltliadntpdsiillfedtkkdriaeyslklmd
idadflkieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsv
iikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfd
lksgflqfflapkfnd