PDB entry 4l5r

View 4l5r on RCSB PDB site
Description: Crystal structure of p202 HIN1 in complex with 20-mer dsDNA
Deposited on 2013-06-11, released 2013-07-31
The last revision was dated 2013-08-21, with a file datestamp of 2013-08-16.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.193
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 20-mer DNA
    Species: synthetic, synthetic
  • Chain 'B':
    Compound: 20-mer DNA
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: Interferon-activable protein 202
    Species: Mus musculus [TaxId:10090]
    Gene: Ifi202, Ifi202a, Ifi202b
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9R002 (0-197)
      • variant (46)
      • variant (65)
      • variant (95-96)
      • variant (158)
  • Heterogens: NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >4l5rC (C:)
tpkkniskgavlhekpmtvmvltatepfnykegkenmfhatvateskyyrvkvfnmdlke
kftenqfitiskyfnssgileinetatvseaapnqmfevpkniirsaketlkiskikeld
sgtliygvfavekkkvndksitfkikdnednikvvwdkeqhninyekgdklqlfsfhlrk
gngkpilhsgnhsfikge