PDB entry 4l5q

View 4l5q on RCSB PDB site
Description: Crystal structure of p202 HIN1
Class: DNA binding protein
Keywords: HIN200, tandem OB-folds, dsDNA binding, DNA BINDING PROTEIN
Deposited on 2013-06-11, released 2013-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-08-21, with a file datestamp of 2013-08-16.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.199
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon-activable protein 202
    Species: Mus musculus [TaxId:10090]
    Gene: Ifi202, Ifi202a, Ifi202b
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9R002 (1-198)
      • expression tag (0)
      • variant (47)
      • variant (66)
      • variant (96-97)
      • variant (159)
    Domains in SCOPe 2.08: d4l5qa1, d4l5qa2, d4l5qa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4l5qA (A:)
stpkkniskgavlhekpmtvmvltatepfnykegkenmfhatvateskyyrvkvfnmdlk
ekftenqfitiskyfnssgileinetatvseaapnqmfevpkniirsaketlkiskikel
dsgtliygvfavekkkvndksitfkikdnednikvvwdkeqhninyekgdklqlfsfhlr
kgngkpilhsgnhsfikge