PDB entry 4l5o

View 4l5o on RCSB PDB site
Description: Crystal structure of 26 kDa GST D26H mutant of Clonorchis sinensis
Class: transferase
Keywords: transferase, GSH binding
Deposited on 2013-06-11, released 2013-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative glutathione transferase
    Species: Clonorchis sinensis [TaxId:79923]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q25595 (0-End)
      • engineered mutation (25)
    Domains in SCOPe 2.07: d4l5oa1, d4l5oa2
  • Chain 'B':
    Compound: putative glutathione transferase
    Species: Clonorchis sinensis [TaxId:79923]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q25595 (0-End)
      • engineered mutation (25)
    Domains in SCOPe 2.07: d4l5ob1, d4l5ob2
  • Chain 'C':
    Compound: putative glutathione transferase
    Species: Clonorchis sinensis [TaxId:79923]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q25595 (0-End)
      • engineered mutation (25)
    Domains in SCOPe 2.07: d4l5oc1, d4l5oc2
  • Heterogens: GSH, SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l5oA (A:)
    mapvlgywkirglaqpirllleyvghsyeehsygrcdgekwqndkhnlglelpnlpyykd
    gnfsltqslailryiadkhnmigntpverakismiegglvdlragvsriayqetfeqlkv
    pylqqlpstlrmwsqflgnnsylhgstpthldfmfyealdviryldptsveafpnlmqfi
    hriealpnikafmesdrfikwplngwsayfgggdappk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l5oA (A:)
    mapvlgywkirglaqpirllleyvghsyeehsygrcdgekwqndkhnlglelpnlpyykd
    gnfsltqslailryiadkhnmigntpverakismiegglvdlragvsriayqetfeqlkv
    pylqqlpstlrmwsqflgnnsylhgstpthldfmfyealdviryldptsveafpnlmqfi
    hriealpnikafmesdrfikwplngwsayfgggdapp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4l5oB (B:)
    mapvlgywkirglaqpirllleyvghsyeehsygrcdgekwqndkhnlglelpnlpyykd
    gnfsltqslailryiadkhnmigntpverakismiegglvdlragvsriayqetfeqlkv
    pylqqlpstlrmwsqflgnnsylhgstpthldfmfyealdviryldptsveafpnlmqfi
    hriealpnikafmesdrfikwplngwsayfgggdappk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l5oB (B:)
    mapvlgywkirglaqpirllleyvghsyeehsygrcdgekwqndkhnlglelpnlpyykd
    gnfsltqslailryiadkhnmigntpverakismiegglvdlragvsriayqetfeqlkv
    pylqqlpstlrmwsqflgnnsylhgstpthldfmfyealdviryldptsveafpnlmqfi
    hriealpnikafmesdrfikwplngwsayfgggdapp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4l5oC (C:)
    mapvlgywkirglaqpirllleyvghsyeehsygrcdgekwqndkhnlglelpnlpyykd
    gnfsltqslailryiadkhnmigntpverakismiegglvdlragvsriayqetfeqlkv
    pylqqlpstlrmwsqflgnnsylhgstpthldfmfyealdviryldptsveafpnlmqfi
    hriealpnikafmesdrfikwplngwsayfgggdappk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l5oC (C:)
    mapvlgywkirglaqpirllleyvghsyeehsygrcdgekwqndkhnlglelpnlpyykd
    gnfsltqslailryiadkhnmigntpverakismiegglvdlragvsriayqetfeqlkv
    pylqqlpstlrmwsqflgnnsylhgstpthldfmfyealdviryldptsveafpnlmqfi
    hriealpnikafmesdrfikwplngwsayfgggdapp