PDB entry 4l5f

View 4l5f on RCSB PDB site
Description: Crystal Structure of DENV1-E106 Fab bound to DENV-1 Envelope protein DIII
Class: viral protein, immune system
Keywords: antibody, FAB, neutralizing, virus, envelope, viral protein, immune system, antibody epitope, infectious disease, Center for Structural Genomics of Infectious Diseases (CSGID), NIAID, National Institute of Allergy and Infectious Diseases
Deposited on 2013-06-11, released 2013-12-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.192
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: envelope protein
    Species: Dengue virus 1 [TaxId:11053]
    Gene: E
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4l5fe_
  • Chain 'H':
    Compound: Heavy chain of E106 antibody (VH and CH1 of IgG2c)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4L5F (0-217)
  • Chain 'L':
    Compound: Light chain of E106 antibody (kappa)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4L5F (0-212)
    Domains in SCOPe 2.04: d4l5fl1, d4l5fl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >4l5fE (E:)
masmtlkgmsyvmctgsfklekevaetqhgtvlvqvkyegtdapckipfstqdekgatqn
grlitanpivtdkekpvnieaeppfgesyivvgagekalklswfkkgssig

    Sequence, based on observed residues (ATOM records): (download) 
    >4l5fE (E:)
msyvmctgsfklekevaetqhgtvlvqvkyegtdapckipfstqdekgatqngrlitanp
ivtdkekpvnieaeppfgesyivvgagekalklswfkk

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4l5fL (L:)
ettvtqspaslsvatgekvtircitstdidddmnwyqqkpgerpkllisegntlrpgvps
rfsssgygtdfvftientlsedvadyfclqsdnlpltfgsgtkleikradaaptvsifpp
sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnrne