PDB entry 4l5e

View 4l5e on RCSB PDB site
Description: Crystal structure of A. aeolicus NtrC1 DNA binding domain
Deposited on 2013-06-10, released 2013-08-28
The last revision was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: 0.176
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator (NtrC family)
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: ntrC1, aq_1117
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67198 (0-45)
      • conflict (38)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4l5eA (A:)
hksikeiekeeiikvlkevnfnkklaseilgiplrtlykrlkeygi