PDB entry 4l54

View 4l54 on RCSB PDB site
Description: Structure of cytochrome P450 OleT, ligand-free
Class: oxidoreductase
Keywords: peroxidase, decarboxylase, OXIDOREDUCTASE
Deposited on 2013-06-10, released 2013-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Terminal olefin-forming fatty acid decarboxylase
    Species: Jeotgalicoccus sp. ATCC 8456 [TaxId:946435]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4l54a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l54A (A:)
    matlkrdkgldntlkvlkqgylyttnqrnrlntsvfqtkalggkpfvvvtgkegaemfyn
    ndvvqregmlpkrivntlfgkgaihtvdgkkhvdrkalfmslmtegnlnyvreltrtlwh
    antqrmesmdevniyresivlltkvgtrwagvqappedieriatdmdimidsfralggaf
    kgykaskearrrvedwleeqiietrkgnihppegtalyefahwedylgnpmdsrtcaidl
    mntfrpliainrfvsfglhamnenpitrekiksepdyaykfaqevrryypfvpflpgkak
    vdidfqgvtipagvglaldvygtthdeslwddpnefrperfetwdgspfdlipqgggdyw
    tnhrcagewitviimeetmkyfaekitydvpeqdlevdlnsipgyvksgfviknvrevvd
    rt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l54A (A:)
    lkrdkgldntlkvlkqgylyttnqrnrlntsvfqtkalggkpfvvvtgkegaemfynndv
    vqregmlpkrivntlfgkgaihtvdgkkhvdrkalfmslmtegnlnyvreltrtlwhant
    qrmesmdevniyresivlltkvgtrwagvqappedieriatdmdimidsfralggafkgy
    kaskearrrvedwleeqiietrkgnihppegtalyefahwedylgnpmdsrtcaidlmnt
    frpliainrfvsfglhamnenpitrekiksepdyaykfaqevrryypfvpflpgkakvdi
    dfqgvtipagvglaldvygtthdeslwddpnefrperfetwdgspfdlipqgggdywtnh
    rcagewitviimeetmkyfaekitydvpeqdlevdlnsipgyvksgfviknvrevvdrt