PDB entry 4l4e

View 4l4e on RCSB PDB site
Description: Structure of cyanide and camphor bound P450cam mutant L358A/K178G
Class: oxidoreductase
Keywords: mono-oxygenase, cytochrome P450, OXIDOREDUCTASE
Deposited on 2013-06-07, released 2013-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-414)
      • engineered mutation (178)
      • engineered mutation (334)
      • engineered mutation (358)
    Domains in SCOPe 2.07: d4l4ea_
  • Heterogens: HEM, CYN, CAM, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l4eA (A:)
    mttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcn
    gghwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvv
    gmpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlgy
    ltdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeak
    rmcglllvggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgr
    iltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlcag
    qhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l4eA (A:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlgyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlcagqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav