PDB entry 4l41

View 4l41 on RCSB PDB site
Description: Human Lactose synthase: A 2:1 complex between human alpha-lactalbumin and human beta1,4-galactosyltransferase
Class: Calcium Binding Protein/Transferase
Keywords: GT-A fold, lactose synthase, Substrate binding, Golgi, Calcium Binding Protein-Transferase complex
Deposited on 2013-06-07, released 2013-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-02, with a file datestamp of 2013-09-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.19
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lactalbumin
    Species: Homo sapiens [TaxId:9606]
    Gene: 4-galactosyltransferase, beta1, LALBA, LYZL7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4l41a_
  • Chain 'B':
    Compound: alpha-lactalbumin
    Species: Homo sapiens [TaxId:9606]
    Gene: 4-galactosyltransferase, beta1, LALBA, LYZL7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4l41b_
  • Chain 'C':
    Compound: Beta-1,4-galactosyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: alpha-lactalbumin, B4GALT1, GGTB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15291 (14-286)
      • engineered mutation (225-226)
    Domains in SCOPe 2.07: d4l41c_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l41A (A:)
    akqftkcelsqllkdidgyggialpelictmfhtsgydtqaivennesteyglfqisnkl
    wckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwl
    cekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l41A (A:)
    akqftkcelsqllkdidgyggialpelictmfhtsgydtqaivennesteyglfqisnkl
    wckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwl
    cek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4l41B (B:)
    akqftkcelsqllkdidgyggialpelictmfhtsgydtqaivennesteyglfqisnkl
    wckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwl
    cekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l41B (B:)
    akqftkcelsqllkdidgyggialpelictmfhtsgydtqaivennesteyglfqisnkl
    wckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwl
    ce
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4l41C (C:)
    asmtggqqmgrgsaslpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprd
    cvsphkvaiiipfrnrqehlkywlyylhpvlqrqqldygiyvinqagdtifnrakllnvg
    fqealkdydytcfvfsdvdlipmndhnayrcfsqprhisvamdkfgfslpyvqyfggvsa
    lskqqfltingfpnnywgwggedddifnrlvfrgmsisrpnavvgttrmirhsrdkknep
    npqrfdriahtketmlsdglnsltyqvldvqryplytqitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l41C (C:)
    slpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprdcvsphkvaiiipfr
    nrqehlkywlyylhpvlqrqqldygiyvinqagdtifnrakllnvgfqealkdydytcfv
    fsdvdlipmndhnayrcfsqprhisvamdkfgfslpyvqyfggvsalskqqfltingfpn
    nywgwggedddifnrlvfrgmsisrpnavvgttrmirhsrdkknepnpqrfdriahtket
    mlsdglnsltyqvldvqryplytqitvdigtps