PDB entry 4l40

View 4l40 on RCSB PDB site
Description: Structure of the P450 OleT with a C20 fatty acid substrate bound
Class: oxidoreductase
Keywords: cytochrome P450, peroxygenase, fatty acid decarboxylase, OXIDOREDUCTASE
Deposited on 2013-06-07, released 2013-11-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.199
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Terminal olefin-forming fatty acid decarboxylase
    Species: Jeotgalicoccus sp. ATCC 8456 [TaxId:946435]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4l40a_
  • Heterogens: HEM, DCR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l40A (A:)
    matlkrdkgldntlkvlkqgylyttnqrnrlntsvfqtkalggkpfvvvtgkegaemfyn
    ndvvqregmlpkrivntlfgkgaihtvdgkkhvdrkalfmslmtegnlnyvreltrtlwh
    antqrmesmdevniyresivlltkvgtrwagvqappedieriatdmdimidsfralggaf
    kgykaskearrrvedwleeqiietrkgnihppegtalyefahwedylgnpmdsrtcaidl
    mntfrpliainrfvsfglhamnenpitrekiksepdyaykfaqevrryypfvpflpgkak
    vdidfqgvtipagvglaldvygtthdeslwddpnefrperfetwdgspfdlipqgggdyw
    tnhrcagewitviimeetmkyfaekitydvpeqdlevdlnsipgyvksgfviknvrevvd
    rt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l40A (A:)
    lkrdkgldntlkvlkqgylyttnqrnrlntsvfqtkalggkpfvvvtgkegaemfynndv
    vqregmlpkrivntlfgkgaihtvdgkkhvdrkalfmslmtegnlnyvreltrtlwhant
    qrmesmdevniyresivlltkvgtrwagvqappedieriatdmdimidsfralggafkgy
    kaskearrrvedwleeqiietrkgnihppegtalyefahwedylgnpmdsrtcaidlmnt
    frpliainrfvsfglhamnenpitrekiksepdyaykfaqevrryypfvpflpgkakvdi
    dfqgvtipagvglaldvygtthdeslwddpnefrperfetwdgspfdlipqgggdywtnh
    rcagewitviimeetmkyfaekitydvpeqdlevdlnsipgyvksgfviknvrevvdrt