PDB entry 4l3g

View 4l3g on RCSB PDB site
Description: Crystal Structure of the E113Q-MauG/pre-Methylamine Dehydrogenase Complex Aged 120 Days
Class: oxidoreductase
Keywords: Oxidoreductase, electron transfer
Deposited on 2013-06-05, released 2013-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.16
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Methylamine utilization protein MauG
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: mauG, Pden_4736
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q51658
    • engineered mutation (112)
• Chain 'B':
  Compound: Methylamine utilization protein MauG
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: mauG, Pden_4736
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q51658
    • engineered mutation (112)
• Chain 'C':
  Compound: Methylamine dehydrogenase light chain
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: Pden_4733
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1BBA0 (Start-130)
  Domains in SCOPe 2.08: d4l3gc_
• Chain 'D':
  Compound: Methylamine dehydrogenase heavy chain
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: Pden_4730
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1BB97 (Start-384)
• Chain 'E':
  Compound: Methylamine dehydrogenase light chain
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: Pden_4733
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1BBA0 (Start-130)
  Domains in SCOPe 2.08: d4l3ge_
• Chain 'F':
  Compound: Methylamine dehydrogenase heavy chain
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: Pden_4730
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1BB97 (Start-384)
• Heterogens: CA, HEC, NA, ACT, PGE, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >4l3gC (C:)
  adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
  cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
  ctispivgkashhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4l3gC (C:)
  tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
  gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
  vgkas
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence, based on SEQRES records: (download)
  

  >4l3gE (E:)
  adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
  cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
  ctispivgkashhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4l3gE (E:)
  tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
  gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
  vgkas
  

  
  
• Chain 'F':
  No sequence available.