PDB entry 4l2n

View 4l2n on RCSB PDB site
Description: Understanding Extradiol Dioxygenase Mechanism in NAD+ Biosynthesis by Viewing Catalytic Intermediates - ligand-free structure
Class: oxidoreductase
Keywords: bi-cupin iron-binding, dioxygenase, Oxidoreductase
Deposited on 2013-06-04, released 2015-05-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyanthranilate 3,4-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:266264]
    Gene: Cupriavidus metallidurans, nbaC, Rmet_5193
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4l2na_
  • Heterogens: FE2, CL, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4l2nA (A:)
mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg
fewycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpgraa