PDB entry 4l2m

View 4l2m on RCSB PDB site
Description: Crystal structure of the 2/2 hemoglobin from Synechococcus sp. PCC 7002 in the cyanomet state and with covalently attached heme
Class: unknown function
Keywords: group I 2/2 hemoglobin, GlbN, trHbN, cyanomet hemoglobin, histidine-heme covalent linkage, truncated hemoglobin, UNKNOWN FUNCTION
Deposited on 2013-06-04, released 2013-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.221
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cyanoglobin
  Species: Synechococcus sp. [TaxId:32049]
  Gene: glbN, SYNPCC7002_A1621
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8RT58 (0-122)
  Domains in SCOPe 2.08: d4l2ma_
• Chain 'B':
  Compound: Cyanoglobin
  Species: Synechococcus sp. [TaxId:32049]
  Gene: glbN, SYNPCC7002_A1621
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8RT58 (0-122)
  Domains in SCOPe 2.08: d4l2mb_
• Heterogens: HEB, CYN, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4l2mA (A:)
  aslyeklggaaavdlavekfygkvladervnrffvntdmakqkqhqkdfmtyafggtdrf
  pgrsmraahqdlvenagltdvhfdaiaenlvltlqelnvsqdlidevvtivgsvqhrndv
  lnr
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4l2mB (B:)
  aslyeklggaaavdlavekfygkvladervnrffvntdmakqkqhqkdfmtyafggtdrf
  pgrsmraahqdlvenagltdvhfdaiaenlvltlqelnvsqdlidevvtivgsvqhrndv
  lnr