PDB entry 4l2b

View 4l2b on RCSB PDB site
Description: X-ray structure of the C57S mutant of the iron superoxide dismutase from Pseudoalteromonas haloplanktis
Class: oxidoreductase
Keywords: Superoxide dismutase, C57S mutant, OXIDOREDUCTASE
Deposited on 2013-06-04, released 2014-02-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.198
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase [fe]
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Gene: sodB, PSHAa1215
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84612 (0-191)
      • engineered mutation (56)
    Domains in SCOPe 2.03: d4l2ba1, d4l2ba2
  • Chain 'B':
    Compound: superoxide dismutase [fe]
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Gene: sodB, PSHAa1215
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84612 (0-191)
      • engineered mutation (56)
  • Heterogens: FE, TRE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l2bA (A:)
    afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivsssd
    ggvfnnaaqiwnhtfywnslspngggaptgavadainakwgsfdafkealndkavnnfgs
    swtwlvkladgsldivntsnaatpltddgvtpiltvdlwehayyidyrnvrpdylkgfws
    lvnwefananfa
    

  • Chain 'B':
    No sequence available.