PDB entry 4l21

View 4l21 on RCSB PDB site
Description: Crystal structure of Cimex nitrophorin F64V mutant ferrous NO complex
Class: transport protein
Keywords: beta sandwich, ferrous heme, thiolate heme ligand, s-nitrosocysteine, transport protein
Deposited on 2013-06-04, released 2014-06-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.182
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Salivary nitrophorin
    Species: Cimex lectularius [TaxId:79782]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76745 (0-279)
      • engineered mutation (61)
    Domains in SCOPe 2.04: d4l21a_
  • Heterogens: HEM, NO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l21A (A:)
    ppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk
    nvqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf
    tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath
    akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt
    dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl