PDB entry 4l1y

View 4l1y on RCSB PDB site
Description: Crystal structure of Cimex nitrophorin A21V mutant
Class: transport protein
Keywords: beta sandwich, ferric heme, thiolate heme ligand, Transport protein
Deposited on 2013-06-04, released 2014-09-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.222
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Salivary nitrophorin
    Species: Cimex lectularius [TaxId:79782]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76745 (0-279)
      • engineered mutation (18)
    Domains in SCOPe 2.04: d4l1ya_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l1yA (A:)
    ppaqlsvhtvswnsghervptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk
    nfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf
    tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath
    akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt
    dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl