PDB entry 4l1p

View 4l1p on RCSB PDB site
Description: Crystal Structure of Human Rtf1 Plus3 domain
Class: transcription
Keywords: Tutor, Plus3, Peptide binding protein, Spt5 CTR binding, Transcription, Paf1 complex, Rtf1, ORF association region, Chromatin
Deposited on 2013-06-03, released 2013-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.208
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase-associated protein RTF1 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0252, RTF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92541 (6-End)
      • expression tag (4-5)
    Domains in SCOPe 2.06: d4l1pa1, d4l1pa2
  • Chain 'B':
    Compound: RNA polymerase-associated protein RTF1 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0252, RTF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92541 (6-End)
      • expression tag (4-5)
    Domains in SCOPe 2.06: d4l1pb1, d4l1pb2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l1pA (A:)
    gdithmvslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignhnskpvyrvaeit
    gvvetakvyqlggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmql
    ptldeinkkelsikealn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l1pA (A:)
    hmvslpeelnrvrlsrhklerwchmpffaktvtgcfvrigipvyrvaeitgvvetakvyq
    lggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmqlptldeinkke
    lsikeal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4l1pB (B:)
    gdithmvslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignhnskpvyrvaeit
    gvvetakvyqlggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmql
    ptldeinkkelsikealn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l1pB (B:)
    hmvslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignhnskpvyrvaeitgvve
    takvyqlggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmqlptld
    einkkelsikea