PDB entry 4l1h

View 4l1h on RCSB PDB site
Description: Bence-Jones immunoglobulin REI variable portion with seven point mutations
Class: immune system
Keywords: immunoglobulin kappa-chains, recombinant, IMMUNE SYSTEM
Deposited on 2013-06-03, released 2014-06-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig kappa chain V-I region Rei
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01607 (0-106)
      • engineered mutation (23)
      • engineered mutation (33)
      • engineered mutation (38)
      • engineered mutation (70)
      • engineered mutation (72)
      • engineered mutation (82)
      • engineered mutation (104)
    Domains in SCOPe 2.08: d4l1ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4l1hA (A:)
diqmtqspsslsasvgdrvtitcrasqdiikylawyqqkpgkapklliyeasnlqagvps
rfsgsgsgtdftltisslqpedfatyycqqyqslpytfgqgtkleit