PDB entry 4l1f

View 4l1f on RCSB PDB site
Description: Electron transferring flavoprotein of Acidaminococcus fermentans: Towards a mechanism of flavin-based electron bifurcation
Class: electron transport
Keywords: FAD, Butyryl-CoA Dehydrogenase, electron transferring flavoprotein (Etf), NADH, ELECTRON TRANSPORT
Deposited on 2013-06-03, released 2014-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.155
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl-CoA dehydrogenase domain protein
    Species: Acidaminococcus fermentans [TaxId:591001]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4l1fa1, d4l1fa2
  • Chain 'B':
    Compound: Acyl-CoA dehydrogenase domain protein
    Species: Acidaminococcus fermentans [TaxId:591001]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4l1fb1, d4l1fb2
  • Heterogens: FAD, COS, NA, PDO, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l1fA (A:)
    mdfnltedqqmikdmaaefaekflaptveerdkahiwdrklidkmgeagfcgicfpeeyg
    gmgldvlsyilaveelskvddgtgitlsanvslcatpiymfgteeqkqkylapiaegthv
    gafgltepsagtdasaqqttavlkgdkyilngskifitngkeadtyvvfamtdksqgvhg
    isafilekgmpgfrfgkiedkmgghtsitaelifedcevpkenllgkegegfkiametld
    ggrigvaaqalgiaegalaaavkyskereqfgrsiskfqalqfmmadmatkieaarylvy
    haamlknegkpyseaaamakcfasdvamevttdavqifggygytvdypaerymrnakitq
    iyegtnqvmrivtsrallrdkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l1fA (A:)
    mdfnltedqqmikdmaaefaekflaptveerdkahiwdrklidkmgeagfcgicfpeeyg
    gmgldvlsyilaveelskvddgtgitlsanvslcatpiymfgteeqkqkylapiaegthv
    gafgltepsagtdasaqqttavlkgdkyilngskifitngkeadtyvvfamtdksqgvhg
    isafilekgmpgfrfgkiedkmgghtsitaelifedcevpkenllgkegegfkiametld
    ggrigvaaqalgiaegalaaavkyskereqfgrsiskfqalqfmmadmatkieaarylvy
    haamlknegkpyseaaamakcfasdvamevttdavqifggygytvdypaerymrnakitq
    iyegtnqvmrivtsrallrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4l1fB (B:)
    mdfnltedqqmikdmaaefaekflaptveerdkahiwdrklidkmgeagfcgicfpeeyg
    gmgldvlsyilaveelskvddgtgitlsanvslcatpiymfgteeqkqkylapiaegthv
    gafgltepsagtdasaqqttavlkgdkyilngskifitngkeadtyvvfamtdksqgvhg
    isafilekgmpgfrfgkiedkmgghtsitaelifedcevpkenllgkegegfkiametld
    ggrigvaaqalgiaegalaaavkyskereqfgrsiskfqalqfmmadmatkieaarylvy
    haamlknegkpyseaaamakcfasdvamevttdavqifggygytvdypaerymrnakitq
    iyegtnqvmrivtsrallrdkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l1fB (B:)
    mdfnltedqqmikdmaaefaekflaptveerdkahiwdrklidkmgeagfcgicfpeeyg
    gmgldvlsyilaveelskvddgtgitlsanvslcatpiymfgteeqkqkylapiaegthv
    gafgltepsagtdasaqqttavlkgdkyilngskifitngkeadtyvvfamtdksqgvhg
    isafilekgmpgfrfgkiedkmgghtsitaelifedcevpkenllgkegegfkiametld
    ggrigvaaqalgiaegalaaavkyskereqfgrsiskfqalqfmmadmatkieaarylvy
    haamlknegkpyseaaamakcfasdvamevttdavqifggygytvdypaerymrnakitq
    iyegtnqvmrivtsrallrd