PDB entry 4l1e

View 4l1e on RCSB PDB site
Description: Crystal structure of C-Phycocyanin from Leptolyngbya sp. N62DM
Class: photosynthesis
Keywords: alpha-beta dimer, light harvesting protein, thylakoid membrane, PHOTOSYNTHESIS
Deposited on 2013-06-03, released 2014-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.241
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phycocyanin alpha chain
    Species: Leptolyngbya sp. N62DM [TaxId:574115]
    Database cross-references and differences (RAF-indexed):
    • PDB 4L1E (0-161)
    Domains in SCOPe 2.07: d4l1ea_
  • Chain 'B':
    Compound: phycocyanin beta chain
    Species: Leptolyngbya sp. N62DM [TaxId:574115]
    Database cross-references and differences (RAF-indexed):
    • PDB 4L1E (0-171)
    Domains in SCOPe 2.07: d4l1eb_
  • Chain 'C':
    Compound: phycocyanin alpha chain
    Species: Leptolyngbya sp. N62DM [TaxId:574115]
    Database cross-references and differences (RAF-indexed):
    • PDB 4L1E (0-161)
    Domains in SCOPe 2.07: d4l1ec_
  • Chain 'D':
    Compound: phycocyanin beta chain
    Species: Leptolyngbya sp. N62DM [TaxId:574115]
    Database cross-references and differences (RAF-indexed):
    • PDB 4L1E (0-171)
    Domains in SCOPe 2.07: d4l1ed_
  • Chain 'E':
    Compound: phycocyanin alpha chain
    Species: Leptolyngbya sp. N62DM [TaxId:574115]
    Database cross-references and differences (RAF-indexed):
    • PDB 4L1E (0-161)
    Domains in SCOPe 2.07: d4l1ee_
  • Chain 'F':
    Compound: phycocyanin beta chain
    Species: Leptolyngbya sp. N62DM [TaxId:574115]
    Database cross-references and differences (RAF-indexed):
    • PDB 4L1E (0-171)
    Domains in SCOPe 2.07: d4l1ef_
  • Chain 'G':
    Compound: phycocyanin alpha chain
    Species: Leptolyngbya sp. N62DM [TaxId:574115]
    Database cross-references and differences (RAF-indexed):
    • PDB 4L1E (0-161)
    Domains in SCOPe 2.07: d4l1eg_
  • Chain 'H':
    Compound: phycocyanin beta chain
    Species: Leptolyngbya sp. N62DM [TaxId:574115]
    Database cross-references and differences (RAF-indexed):
    • PDB 4L1E (0-171)
    Domains in SCOPe 2.07: d4l1eh_
  • Chain 'I':
    Compound: phycocyanin alpha chain
    Species: Leptolyngbya sp. N62DM [TaxId:574115]
    Database cross-references and differences (RAF-indexed):
    • PDB 4L1E (0-161)
    Domains in SCOPe 2.07: d4l1ei_
  • Chain 'J':
    Compound: phycocyanin beta chain
    Species: Leptolyngbya sp. N62DM [TaxId:574115]
    Database cross-references and differences (RAF-indexed):
    • PDB 4L1E (0-171)
    Domains in SCOPe 2.07: d4l1ej_
  • Chain 'K':
    Compound: phycocyanin alpha chain
    Species: Leptolyngbya sp. N62DM [TaxId:574115]
    Database cross-references and differences (RAF-indexed):
    • PDB 4L1E (0-161)
    Domains in SCOPe 2.07: d4l1ek_
  • Chain 'L':
    Compound: phycocyanin beta chain
    Species: Leptolyngbya sp. N62DM [TaxId:574115]
    Database cross-references and differences (RAF-indexed):
    • PDB 4L1E (0-171)
    Domains in SCOPe 2.07: d4l1el_
  • Heterogens: CYC, BLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l1eA (A:)
    mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
    nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
    tfelspswyiealkyikanhglsgdaaveansyldyainals
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l1eB (B:)
    mfdaftkvvsqadtrgemlstaqidalsqmvaesnkrldvvnritsnastivsnaarslf
    aeqpqliapggnaytstrmaaclrdmeiilryvtyavfagdasvledrclnglretylal
    gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiasyfdracaavs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l1eC (C:)
    mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
    nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
    tfelspswyiealkyikanhglsgdaaveansyldyainals
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l1eD (D:)
    mfdaftkvvsqadtrgemlstaqidalsqmvaesnkrldvvnritsnastivsnaarslf
    aeqpqliapggnaytstrmaaclrdmeiilryvtyavfagdasvledrclnglretylal
    gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiasyfdracaavs
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l1eE (E:)
    mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
    nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
    tfelspswyiealkyikanhglsgdaaveansyldyainals
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l1eF (F:)
    mfdaftkvvsqadtrgemlstaqidalsqmvaesnkrldvvnritsnastivsnaarslf
    aeqpqliapggnaytstrmaaclrdmeiilryvtyavfagdasvledrclnglretylal
    gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiasyfdracaavs
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l1eG (G:)
    mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
    nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
    tfelspswyiealkyikanhglsgdaaveansyldyainals
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l1eH (H:)
    mfdaftkvvsqadtrgemlstaqidalsqmvaesnkrldvvnritsnastivsnaarslf
    aeqpqliapggnaytstrmaaclrdmeiilryvtyavfagdasvledrclnglretylal
    gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiasyfdracaavs
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l1eI (I:)
    mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
    nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
    tfelspswyiealkyikanhglsgdaaveansyldyainals
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l1eJ (J:)
    mfdaftkvvsqadtrgemlstaqidalsqmvaesnkrldvvnritsnastivsnaarslf
    aeqpqliapggnaytstrmaaclrdmeiilryvtyavfagdasvledrclnglretylal
    gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiasyfdracaavs
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l1eK (K:)
    mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
    nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
    tfelspswyiealkyikanhglsgdaaveansyldyainals
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l1eL (L:)
    mfdaftkvvsqadtrgemlstaqidalsqmvaesnkrldvvnritsnastivsnaarslf
    aeqpqliapggnaytstrmaaclrdmeiilryvtyavfagdasvledrclnglretylal
    gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiasyfdracaavs