PDB entry 4l16

View 4l16 on RCSB PDB site
Description: Crystal structure of FIGL-1 AAA domain in complex with ADP
Class: hydrolase
Keywords: AAA domain, HYDROLASE
Deposited on 2013-06-02, released 2013-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.202
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fidgetin-like protein 1
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: figl-1, F32D1.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4l16a_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l16A (A:)
    snplirkamgmdtegggkdekmsglraeptlkhfdeniislieseimsvnneigwadvag
    legakkalreivvlpfkrpdvftgirappkgvllfgppgtgktmigrcvasqckatffni
    sassltskwvgegeklvralfsvarlklpsvifideidsllssrsesehessrriktefl
    vqldgvntapderllvlgatnrpqeldeaarrrfqkrlyialpepesrtqivqnllvgtr
    hditnhnlerireltdgysgadmrqlcteaamgpirdigddietidkddiravtvmdfae
    aarvvrptvddsqldayaawdkkfgclpppsisr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l16A (A:)
    ptlkhfdeniislieseimsvnneigwadvaglegakkalreivvlpfkrpdvftgirap
    pkgvllfgppgtgktmigrcvasqckatffnisassltskwvgegeklvralfsvarlkl
    psvifideidsllsessrrikteflvqldgvntapderllvlgatnrpqeldeaarrrfq
    krlyialpepesrtqivqnllvgtrhditnhnlerireltdgysgadmrqlcteaamgpi
    rdigddietidkddiravtvmdfaeaarvvrptvddsqldayaawdkkfgcl