PDB entry 4l0o

View 4l0o on RCSB PDB site
Description: Structure determination of cystathionine gamma-synthase from Helicobacter pylori
Class: lyase
Keywords: elimination, C-S bond cleavage, LYASE
Deposited on 2013-05-31, released 2013-12-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: 0.236
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cystathionine gamma-synthase
    Species: Helicobacter pylori 26695 [TaxId:85962]
    Gene: cystathionine gamma-synthase, HP_0106, metB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4l0oa_
  • Chain 'C':
    Compound: cystathionine gamma-synthase
    Species: Helicobacter pylori 26695 [TaxId:85962]
    Gene: cystathionine gamma-synthase, HP_0106, metB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4l0oc_
  • Chain 'E':
    Compound: cystathionine gamma-synthase
    Species: Helicobacter pylori 26695 [TaxId:85962]
    Gene: cystathionine gamma-synthase, HP_0106, metB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4l0oe_
  • Chain 'G':
    Compound: cystathionine gamma-synthase
    Species: Helicobacter pylori 26695 [TaxId:85962]
    Gene: cystathionine gamma-synthase, HP_0106, metB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4l0og_
  • Chain 'H':
    Compound: cystathionine gamma-synthase
    Species: Helicobacter pylori 26695 [TaxId:85962]
    Gene: cystathionine gamma-synthase, HP_0106, metB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4l0oh_
  • Chain 'K':
    Compound: cystathionine gamma-synthase
    Species: Helicobacter pylori 26695 [TaxId:85962]
    Gene: cystathionine gamma-synthase, HP_0106, metB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4l0ok_
  • Chain 'M':
    Compound: cystathionine gamma-synthase
    Species: Helicobacter pylori 26695 [TaxId:85962]
    Gene: cystathionine gamma-synthase, HP_0106, metB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4l0om_
  • Chain 'O':
    Compound: cystathionine gamma-synthase
    Species: Helicobacter pylori 26695 [TaxId:85962]
    Gene: cystathionine gamma-synthase, HP_0106, metB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4l0oo_
  • Heterogens: PLP, PO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l0oA (A:)
    mrmqtklihggisedattgavsvpiyqtstyrqdaigrhkgyeysrsgnptrfaleelia
    dleggvkgfafasglagihavfsllqsgdhvllgddvyggtfrlfnqvlvknglsctiid
    tsdisqikkaikpntkalyletpsnpllkitdlaqcasvakdhglltivdntfatpyyqn
    plllgadivahsgtkylgghsdvvaglvttnnealaqeiaffqnaiggvlgpqdswllqr
    giktlglrmeahqknalcvaeflekhpkvervyypglpthpnyelakkqmrgfsgmlsft
    lkndseavafveslklfilgeslggveslvgipafmthacipktqreaagirdglvrlsv
    gieheqdlledleqafakiglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l0oA (A:)
    mrmqtklihggisedattgavsvpiyqtstyrqdaigrhkgyeysrsgnptrfaleelia
    dleggvkgfafasglagihavfsllqsgdhvllgddvyggtfrlfnqvlvknglsctiid
    tsdisqikkaikpntkalyletpsnpllkitdlaqcasvakdhglltivdntfatpyyqn
    plllgadivahsgtkylgghsdvvaglvttnnealaqeiaffqnaiggvlgpqdswllqr
    giktlglrmeahqknalcvaeflekhpkvervyypglpthpnyelakkqmrgfsgmlsft
    lkndseavafveslklfilgeslggveslvgipafmtglvrlsvgieheqdlledleqaf
    aki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4l0oC (C:)
    mrmqtklihggisedattgavsvpiyqtstyrqdaigrhkgyeysrsgnptrfaleelia
    dleggvkgfafasglagihavfsllqsgdhvllgddvyggtfrlfnqvlvknglsctiid
    tsdisqikkaikpntkalyletpsnpllkitdlaqcasvakdhglltivdntfatpyyqn
    plllgadivahsgtkylgghsdvvaglvttnnealaqeiaffqnaiggvlgpqdswllqr
    giktlglrmeahqknalcvaeflekhpkvervyypglpthpnyelakkqmrgfsgmlsft
    lkndseavafveslklfilgeslggveslvgipafmthacipktqreaagirdglvrlsv
    gieheqdlledleqafakiglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l0oC (C:)
    mrmqtklihggisedattgavsvpiyqtstyrqdaiggyeysrsgnptrfaleeliadle
    ggvkgfafasglagihavfsllqsgdhvllgddvyggtfrlfnqvlvknglsctiidtsd
    isqikkaikpntkalyletpsnpllkitdlaqcasvakdhglltivdntfatpyyqnpll
    lgadivahsgtkylgghsdvvaglvttnnealaqeiaffqnaiggvlgpqdswllqrgik
    tlglrmeahqknalcvaeflekhpkvervyypglpthpnyelakkqmrgfsgmlsftlkn
    dseavafveslklfilgeslggveslvgipafmthagirdglvrlsvgieheqdlledle
    qafaki
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4l0oE (E:)
    mrmqtklihggisedattgavsvpiyqtstyrqdaigrhkgyeysrsgnptrfaleelia
    dleggvkgfafasglagihavfsllqsgdhvllgddvyggtfrlfnqvlvknglsctiid
    tsdisqikkaikpntkalyletpsnpllkitdlaqcasvakdhglltivdntfatpyyqn
    plllgadivahsgtkylgghsdvvaglvttnnealaqeiaffqnaiggvlgpqdswllqr
    giktlglrmeahqknalcvaeflekhpkvervyypglpthpnyelakkqmrgfsgmlsft
    lkndseavafveslklfilgeslggveslvgipafmthacipktqreaagirdglvrlsv
    gieheqdlledleqafakiglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l0oE (E:)
    mrmqtklihggisedattgavsvpiyqtstyrqdaigyeysrsgnptrfaleeliadleg
    gvkgfafasglagihavfsllqsgdhvllgddvyggtfrlfnqvlvknglsctiidtsdi
    sqikkaikpntkalyletpsnpllkitdlaqcasvakdhglltivdntfatpyyqnplll
    gadivahsgtkylgghsdvvaglvttnnealaqeiaffqnaiggvlgpqdswllqrgikt
    lglrmeahqknalcvaeflekhpkvervyypglpthpnyelakkqmrgfsgmlsftlknd
    seavafveslklfilgeslggveslvgipafmaagirdglvrlsvgieheqdlledleqa
    faki
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4l0oG (G:)
    mrmqtklihggisedattgavsvpiyqtstyrqdaigrhkgyeysrsgnptrfaleelia
    dleggvkgfafasglagihavfsllqsgdhvllgddvyggtfrlfnqvlvknglsctiid
    tsdisqikkaikpntkalyletpsnpllkitdlaqcasvakdhglltivdntfatpyyqn
    plllgadivahsgtkylgghsdvvaglvttnnealaqeiaffqnaiggvlgpqdswllqr
    giktlglrmeahqknalcvaeflekhpkvervyypglpthpnyelakkqmrgfsgmlsft
    lkndseavafveslklfilgeslggveslvgipafmthacipktqreaagirdglvrlsv
    gieheqdlledleqafakiglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l0oG (G:)
    mrmqtklihggisedattgavsvpiyqtstyrqdaigyeysrsgnptrfaleeliadleg
    gvkgfafasglagihavfsllqsgdhvllgddvyggtfrlfnqvlvknglsctiidtsdi
    sqikkaikpntkalyletpsnpllkitdlaqcasvakdhglltivdntfatpyyqnplll
    gadivahsgtkylgghsdvvaglvttnnealaqeiaffqnaiggvlgpqdswllqrgikt
    lglrmeahqknalcvaeflekhpkvervyypglpthpnyelakkqmrgfsgmlsftlknd
    seavafveslklfilgeslggveslvgipafmtaagirdglvrlsvgieheqdlledleq
    afaki
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4l0oH (H:)
    mrmqtklihggisedattgavsvpiyqtstyrqdaigrhkgyeysrsgnptrfaleelia
    dleggvkgfafasglagihavfsllqsgdhvllgddvyggtfrlfnqvlvknglsctiid
    tsdisqikkaikpntkalyletpsnpllkitdlaqcasvakdhglltivdntfatpyyqn
    plllgadivahsgtkylgghsdvvaglvttnnealaqeiaffqnaiggvlgpqdswllqr
    giktlglrmeahqknalcvaeflekhpkvervyypglpthpnyelakkqmrgfsgmlsft
    lkndseavafveslklfilgeslggveslvgipafmthacipktqreaagirdglvrlsv
    gieheqdlledleqafakiglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l0oH (H:)
    mrmqtklihggisedattgavsvpiyqtstyrqdgyeysrsgnptrfaleeliadleggv
    kgfafasglagihavfsllqsgdhvllgddvyggtfrlfnqvlvknglsctiidtsdisq
    ikkaikpntkalyletpsnpllkitdlaqcasvakdhglltivdntfatpyyqnplllga
    divahsgtkylgghsdvvaglvttnnealaqeiaffqnaiggvlgpqdswllqrgiktlg
    lrmeahqknalcvaeflekhpkvervyypglpthpnyelakkqmrgfsgmlsftlkndse
    avafveslklfilgeslggveslvgipafmthacipktqreaagirdglvrlsvgieheq
    dlledleqafaki
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4l0oK (K:)
    mrmqtklihggisedattgavsvpiyqtstyrqdaigrhkgyeysrsgnptrfaleelia
    dleggvkgfafasglagihavfsllqsgdhvllgddvyggtfrlfnqvlvknglsctiid
    tsdisqikkaikpntkalyletpsnpllkitdlaqcasvakdhglltivdntfatpyyqn
    plllgadivahsgtkylgghsdvvaglvttnnealaqeiaffqnaiggvlgpqdswllqr
    giktlglrmeahqknalcvaeflekhpkvervyypglpthpnyelakkqmrgfsgmlsft
    lkndseavafveslklfilgeslggveslvgipafmthacipktqreaagirdglvrlsv
    gieheqdlledleqafakiglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l0oK (K:)
    mrmqtklihggisedattgavsvpiyqtstyrqdaigrhgyeysrsgnptrfaleeliad
    leggvkgfafasglagihavfsllqsgdhvllgddvyggtfrlfnqvlvknglsctiidt
    sdisqikkaikpntkalyletpsnpllkitdlaqcasvakdhglltivdntfatpyyqnp
    lllgadivahsgtkylgghsdvvaglvttnnealaqeiaffqnaiggvlgpqdswllqrg
    iktlglrmeahqknalcvaeflekhpkvervyypglpthpnyelakkqmrgfsgmlsftl
    kndseavafveslklfilgeslggveslvgipafmthacipktqreaagirdglvrlsvg
    ieheqdlledleqafaki
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4l0oM (M:)
    mrmqtklihggisedattgavsvpiyqtstyrqdaigrhkgyeysrsgnptrfaleelia
    dleggvkgfafasglagihavfsllqsgdhvllgddvyggtfrlfnqvlvknglsctiid
    tsdisqikkaikpntkalyletpsnpllkitdlaqcasvakdhglltivdntfatpyyqn
    plllgadivahsgtkylgghsdvvaglvttnnealaqeiaffqnaiggvlgpqdswllqr
    giktlglrmeahqknalcvaeflekhpkvervyypglpthpnyelakkqmrgfsgmlsft
    lkndseavafveslklfilgeslggveslvgipafmthacipktqreaagirdglvrlsv
    gieheqdlledleqafakiglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l0oM (M:)
    mrmqtklihggisedattgavsvpiyqtstyrqdaiggyeysrsgnptrfaleeliadle
    ggvkgfafasglagihavfsllqsgdhvllgddvyggtfrlfnqvlvknglsctiidtsd
    isqikkaikpntkalyletpsnpllkitdlaqcasvakdhglltivdntfatpyyqnpll
    lgadivahsgtkylgghsdvvaglvttnnealaqeiaffqnaiggvlgpqdswllqrgik
    tlglrmeahqknalcvaeflekhpkvervyypglpthpnyelakkqmrgfsgmlsftlkn
    dseavafveslklfilgeslggveslvgipafmagirdglvrlsvgieheqdlledleqa
    fakig
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4l0oO (O:)
    mrmqtklihggisedattgavsvpiyqtstyrqdaigrhkgyeysrsgnptrfaleelia
    dleggvkgfafasglagihavfsllqsgdhvllgddvyggtfrlfnqvlvknglsctiid
    tsdisqikkaikpntkalyletpsnpllkitdlaqcasvakdhglltivdntfatpyyqn
    plllgadivahsgtkylgghsdvvaglvttnnealaqeiaffqnaiggvlgpqdswllqr
    giktlglrmeahqknalcvaeflekhpkvervyypglpthpnyelakkqmrgfsgmlsft
    lkndseavafveslklfilgeslggveslvgipafmthacipktqreaagirdglvrlsv
    gieheqdlledleqafakiglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l0oO (O:)
    mrmqtklihggisedattgavsvpiyqtstyrqdaigrhkgyeysrsgnptrfaleelia
    dleggvkgfafasglagihavfsllqsgdhvllgddvyggtfrlfnqvlvknglsctiid
    tsdisqikkaikpntkalyletpsnpllkitdlaqcasvakdhglltivdntfatpyyqn
    plllgadivahsgtkylgghsdvvaglvttnnealaqeiaffqnaiggvlgpqdswllqr
    giktlglrmeahqknalcvaeflekhpkvervyypglpthpnyelakkqmrgfsgmlsft
    lkndseavafveslklfilgeslggveslvgipafmagirdglvrlsvgieheqdlledl
    eqafaki