SCOPe 2.08: Structural Classification of Proteins

PDB entry 4l08

View 4l08 on RCSB PDB site
Description: Crystal structure of the maleamate amidase Ami(C149A) in complex with maleate from Pseudomonas putida S16
Class: hydrolase
Keywords: maleamate amidase, HYDROLASE
Deposited on 2013-05-31, released 2014-07-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Hydrolase, isochorismatase family
Species: Pseudomonas putida [TaxId:1042876]
Gene: PPS_4057
Database cross-references and differences (RAF-indexed):
- Uniprot F8G0M0 (Start-207)
  - engineered mutation (148)
Domains in SCOPe 2.08: d4l08a_
Chain 'B':
Compound: Hydrolase, isochorismatase family
Species: Pseudomonas putida [TaxId:1042876]
Gene: PPS_4057
Database cross-references and differences (RAF-indexed):
- Uniprot F8G0M0 (Start-207)
  - engineered mutation (148)
Domains in SCOPe 2.08: d4l08b_
Chain 'C':
Compound: Hydrolase, isochorismatase family
Species: Pseudomonas putida [TaxId:1042876]
Gene: PPS_4057
Database cross-references and differences (RAF-indexed):
- Uniprot F8G0M0 (Start-207)
  - engineered mutation (148)
Domains in SCOPe 2.08: d4l08c_
Chain 'D':
Compound: Hydrolase, isochorismatase family
Species: Pseudomonas putida [TaxId:1042876]
Gene: PPS_4057
Database cross-references and differences (RAF-indexed):
- Uniprot F8G0M0 (Start-207)
  - engineered mutation (148)
Domains in SCOPe 2.08: d4l08d_
Chain 'E':
Compound: Hydrolase, isochorismatase family
Species: Pseudomonas putida [TaxId:1042876]
Gene: PPS_4057
Database cross-references and differences (RAF-indexed):
- Uniprot F8G0M0 (Start-207)
  - engineered mutation (148)
Domains in SCOPe 2.08: d4l08e_
Chain 'F':
Compound: Hydrolase, isochorismatase family
Species: Pseudomonas putida [TaxId:1042876]
Gene: PPS_4057
Database cross-references and differences (RAF-indexed):
- Uniprot F8G0M0 (Start-207)
  - engineered mutation (148)
Domains in SCOPe 2.08: d4l08f_
Chain 'G':
Compound: Hydrolase, isochorismatase family
Species: Pseudomonas putida [TaxId:1042876]
Gene: PPS_4057
Database cross-references and differences (RAF-indexed):
- Uniprot F8G0M0 (Start-207)
  - engineered mutation (148)
Domains in SCOPe 2.08: d4l08g_
Chain 'H':
Compound: Hydrolase, isochorismatase family
Species: Pseudomonas putida [TaxId:1042876]
Gene: PPS_4057
Database cross-references and differences (RAF-indexed):
- Uniprot F8G0M0 (Start-207)
  - engineered mutation (148)
Domains in SCOPe 2.08: d4l08h_
Heterogens: MAE, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4l08A (A:)
msqkevydaagfgnpvsrgvhpaiivvdfsygftdlqyptasdaslqmsrtkeicdlara
lefpvifttiayhpgeipmlpwlekssgmaallygsrlveidmatgiqpndvvvvkkgas
sffgstlssllagtntdtvvvtgattsgavratvvdavqsgfkvlvpadccadrakgphe
aslydiqqkygdvtdsddilkwlrsvag