PDB entry 4l05

View 4l05 on RCSB PDB site
Description: Cu/Zn superoxide dismutase from Brucella abortus
Class: oxidoreductase
Keywords: superoxide dismutase, Brucella abortus, OXIDOREDUCTASE
Deposited on 2013-05-30, released 2013-10-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Brucella abortus [TaxId:235]
    Gene: sodC, BruAb2_0527
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4l05a_
  • Heterogens: CU1, CU, ZN, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l05A (A:)
    esttvkmyealptgpgkevgtvviseapgglhfkvnmekltpgyhgfhvhenpscapgek
    dgkivpalaagghydpgnthhhlgpegdghmgdlprlsanadgkvsetvvaphlkklaei
    kqrslmvhvggdnysdkpeplggggarfacgvie