PDB entry 4kzw

View 4kzw on RCSB PDB site
Description: Structure of the carbohydrate-recognition domain of the C-type lectin mincle
Class: Carbohydrate-binding protein
Keywords: C-type lectin, carbohydrate recognition domain, Carbohydrate-binding protein
Deposited on 2013-05-30, released 2013-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin mincle
    Species: Bos taurus [TaxId:9913]
    Gene: CLEC4E
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1BHM0 (1-130)
      • see remark 999 (96)
      • see remark 999 (131-133)
    Domains in SCOPe 2.07: d4kzwa_
  • Chain 'B':
    Compound: C-type lectin mincle
    Species: Bos taurus [TaxId:9913]
    Gene: CLEC4E
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1BHM0 (1-130)
      • expression tag (0)
      • see remark 999 (131-133)
    Domains in SCOPe 2.07: d4kzwb1, d4kzwb2
  • Heterogens: FLC, CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kzwA (A:)
    acplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefy
    igltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnprqnwndvpcf
    fnmfrvcemperki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kzwA (A:)
    cplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefyi
    gltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnprqnwndvpcff
    nmfrvcemperki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kzwB (B:)
    acplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefy
    igltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnprqnwndvpcf
    fnmfrvcemperki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kzwB (B:)
    acplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefy
    igltdqvtegqwqwvdgtpftkslsfwdagepnnvedcatirdssnprqnwndvpcffnm
    frvcemperki