PDB entry 4ky1

View 4ky1 on RCSB PDB site
Description: humanized HP1/2 Fab
Class: immune system
Keywords: Fab, antibody, alpha4 integrin, IMMUNE SYSTEM
Deposited on 2013-05-28, released 2013-07-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 2.97 Å
R-factor: 0.21
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin IgG1 Fab, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KY1 (0-219)
  • Chain 'L':
    Compound: immunoglobulin IgG1 Fab, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KY1 (0-212)
    Domains in SCOPe 2.05: d4ky1l1, d4ky1l2

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ky1L (L:)
    divmtqspdslavslgeratinckasqsvtndvawyqqkpgqppklliyyasnrytgvpd
    rfsgsgsgtdftltisslqaedvavyycqqdysspytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge