PDB entry 4kx4

View 4kx4 on RCSB PDB site
Description: Crystal structure of Escherichia coli glutaredoxin 2 complex with glutathione
Class: electron transport
Keywords: glutaredoxin 2, glutathione, ELECTRON TRANSPORT
Deposited on 2013-05-24, released 2014-05-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-28, with a file datestamp of 2014-05-23.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.165
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaredoxin-2
    Species: Escherichia coli [TaxId:83333]
    Gene: grxB, b1064, JW1051
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AC59 (2-216)
      • expression tag (0-1)
      • conflict (88)
    Domains in SCOPe 2.06: d4kx4a1, d4kx4a2, d4kx4a3
  • Heterogens: GSH, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4kx4A (A:)
samklyiydhcpyclkarmifglknipvelhvllnddaetptrmvgqkqvpilqkddsry
mpesmdivhyvdkldgkplltgkrspaidewlrkvngyanklllprfaksafdefstpaa
rkyfvdkkeasagnfadllahsdgliknisddlraldklivkpnavngelseddiqlfpl
lrnltlvaginwpsrvadyrdnmakqtqinllssmai