PDB entry 4kwe

View 4kwe on RCSB PDB site
Description: GDP-bound, double-stranded, curved FtsZ protofilament structure
Class: GTP-binding protein
Keywords: Rossmann Fold, bacterial cell division,, GTP-BINDING PROTEIN
Deposited on 2013-05-23, released 2013-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: 0.242
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: ftsZ, MT2209, MTCY270.18, Rv2150c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kwea1, d4kwea2
  • Chain 'B':
    Compound: cell division protein ftsz
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: ftsZ, MT2209, MTCY270.18, Rv2150c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kweb1, d4kweb2
  • Chain 'C':
    Compound: cell division protein ftsz
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: ftsZ, MT2209, MTCY270.18, Rv2150c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kwec1, d4kwec2
  • Heterogens: GDP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kweA (A:)
    gshmtpphnylavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkld
    vgrdstrglgagadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasi
    arklgaltvgvvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslm
    dafrsadevllngvqgitdlittpglinvdfadvkgimsgagtalmgigsargegrslka
    aeiainsplleasmegaqgvlmsiaggsdlglfeineaaslvqdaahpdaniifgtvidd
    slgdevrvtviaagfdvsgpgrkpvmgetggahriesakagkltstlfepvdavsvplht
    ngatlsiggddddvdvppfmrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kweA (A:)
    lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstrglg
    agadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvg
    vvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevl
    lngvqgitdlittpglinvdfadvkgimsgagtalmgigsargegrslkaaeiainspll
    easmegaqgvlmsiaggsdlglfeineaaslvqdaahpdaniifgtviddslgdevrvtv
    iaagf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kweB (B:)
    gshmtpphnylavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkld
    vgrdstrglgagadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasi
    arklgaltvgvvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslm
    dafrsadevllngvqgitdlittpglinvdfadvkgimsgagtalmgigsargegrslka
    aeiainsplleasmegaqgvlmsiaggsdlglfeineaaslvqdaahpdaniifgtvidd
    slgdevrvtviaagfdvsgpgrkpvmgetggahriesakagkltstlfepvdavsvplht
    ngatlsiggddddvdvppfmrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kweB (B:)
    lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgadpevgrk
    aaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvgvvtrpfsfeg
    krrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevllngvqgitdl
    ittpglinvdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmegaqgv
    lmsiaggsdlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kweC (C:)
    gshmtpphnylavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkld
    vgrdstrglgagadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasi
    arklgaltvgvvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslm
    dafrsadevllngvqgitdlittpglinvdfadvkgimsgagtalmgigsargegrslka
    aeiainsplleasmegaqgvlmsiaggsdlglfeineaaslvqdaahpdaniifgtvidd
    slgdevrvtviaagfdvsgpgrkpvmgetggahriesakagkltstlfepvdavsvplht
    ngatlsiggddddvdvppfmrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kweC (C:)
    lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgadpevgrk
    aaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvgvvtrpfsfeg
    krrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevllngvqgitdl
    ittpglinvdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmegaqgv
    lmsiaggsdlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf