PDB entry 4kvq

View 4kvq on RCSB PDB site
Description: Crystal Structure of Prochlorococcus marinus aldehyde-deformylating oxygenase wild type with palmitic acid bound
Class: oxidoreductase
Keywords: Propane production, Aldehyde-deformylating oxygenase, oxidoreductase
Deposited on 2013-05-23, released 2013-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.18
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldehyde decarbonylase
    Species: PROCHLOROCOCCUS MARINUS [TaxId:74547]
    Gene: PMT_1231
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kvqa_
  • Heterogens: FE, PLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kvqA (A:)
    gmptlempvaavldstvgssealpdftsdrykdaysrinaiviegeqeahdnyiaigtll
    pdhveelkrlakmemrhkkgftacgknlgveadmdfareffaplrdnfqtalgqgktptc
    lliqallieafaisayhtyipvsdpfarkitegvvkdeythlnygeawlkanlescreel
    leanrenlplirrmldqvagdaavlqmdkedliedfliayqeslteigfntreitrmaaa
    alvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kvqA (A:)
    sealpdftsdrykdaysrinaiviegeqeahdnyiaigtllpdhveelkrlakmemrhkk
    gftacgknlgveadmdfareffaplrdnfqtalgqgktptclliqallieafaisayhty
    ipvsdpfarkitegvvkdeythlnygeawlkanlescreelleanrenlplirrmldqva
    gdaavlqmdkedliedfliayqeslteigfntreitrmaaaal