PDB entry 4kue

View 4kue on RCSB PDB site
Description: Crystal structure of 3-hydroxybutylryl-CoA dehydrogenase from Clostridium butyricum
Class: oxidoreductase
Keywords: HCDH C-domain-like/NAD(P)-binding protein, beta-hydroxyacyl-CoA dehydrogenase activity, OXIDOREDUCTASE
Deposited on 2013-05-22, released 2014-05-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-28, with a file datestamp of 2014-05-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium butyricum [TaxId:632245]
    Gene: hbd, CLP_3850
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kuea1, d4kuea2
  • Chain 'B':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium butyricum [TaxId:632245]
    Gene: hbd, CLP_3850
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kueb1, d4kueb2
  • Chain 'C':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium butyricum [TaxId:632245]
    Gene: hbd, CLP_3850
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kuec1, d4kuec2
  • Chain 'D':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium butyricum [TaxId:632245]
    Gene: hbd, CLP_3850
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kued1, d4kued2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kueA (A:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydyskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kueA (A:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kueB (B:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydyskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kueB (B:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kueC (C:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydyskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kueC (C:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4kueD (D:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydyskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kueD (D:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydy