PDB entry 4kub

View 4kub on RCSB PDB site
Description: Crystal structure of a GNAT superfamily acetyltransferase PA4794 in complex with CoA
Class: transferase
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, GNAT, acetyltransferase, TRANSFERASE
Deposited on 2013-05-21, released 2013-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.144
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GNAT superfamily acetyltransferase PA4794
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA4794
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HV14 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.08: d4kuba1, d4kuba2
  • Heterogens: COA, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kubA (A:)
    ghmqlshrpaetgdletvagfpqdrdelfycypkaiwpfsvaqlaaaiaerrgstvavhd
    gqvlgfanfyqwqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkiscf
    nanaaglllytqlgyqpraiaerhdpdgrrvaliqmdkplep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kubA (A:)
    hmqlshrpaetgdletvagfpqdrdelfycypkaiwpfsvaqlaaaiaerrgstvavhdg
    qvlgfanfyqwqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkiscfn
    anaaglllytqlgyqpraiaerhdpdgrrvaliqmdkple