PDB entry 4ktu

View 4ktu on RCSB PDB site
Description: Bovine trypsin in complex with microviridin J at pH 6.5
Class: hydrolase/hydrolase inhibitor
Keywords: Serine protease, Hydrolase, Natural product inhibitor, Trypsin, Protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2013-05-21, released 2014-04-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.136
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ktua_
  • Chain 'B':
    Compound: microviridin j
    Species: Microcystis aeruginosa MRC [TaxId:507735]
    Gene: mdnA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ktuA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

  • Chain 'B':
    No sequence available.