PDB entry 4kts

View 4kts on RCSB PDB site
Description: Bovine trypsin in complex with microviridin J at pH 8.5
Class: hydrolase/hydrolase inhibitor
Keywords: Serine protease, Hydrolase, Natural product inhibitor, Protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2013-05-21, released 2014-04-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.107
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4ktsa_
  • Chain 'B':
    Compound: Microviridin
    Species: Microcystis aeruginosa MRC [TaxId:507735]
    Gene: mdnA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ktsA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'B':
    No sequence available.