PDB entry 4ktq

View 4ktq on RCSB PDB site
Description: binary complex of the large fragment of dna polymerase i from t. aquaticus bound to a primer/template dna
Deposited on 1998-09-09, released 1999-01-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.227
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ktqA (A:)
    leeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkearglla
    kdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserlf
    anlwgrlegeerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleae
    vfrlaghpfnlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekil
    qyreltklkstyidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqr
    irrafiaeegwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvprea
    vdplmrraaktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektlee
    grrrgyvetlfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprle
    emgarmllqvhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake