PDB entry 4kth

View 4kth on RCSB PDB site
Description: Structure of A/Hubei/1/2010 H5 HA
Class: viral protein
Keywords: hemagglutinin, VIRAL PROTEIN
Deposited on 2013-05-20, released 2013-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.236
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1087279]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot G2U0T8 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d4ktha1, d4ktha2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1087279]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kthb_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1087279]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot G2U0T8 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d4kthc1, d4kthc2
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1087279]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot G2U0T8
      • conflict (174)
    Domains in SCOPe 2.07: d4kthd1, d4kthd2
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1087279]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot G2U0T8 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d4kthe1, d4kthe2
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1087279]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kthf_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kthA (A:)
    adpgdhicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcs
    vagwllgnpmcdefinvpewsyivekanpandlcypgnfndyeelkhllsrinhfekiqi
    ipknswsdheaslgvsaacpyqgkssffrnvvwlikkdnayptikkgynntnqedllvlw
    gihhpndeaeqtrlyqnpttyisigtstlnqrlvpkiatrskingqsgridffwtilkpn
    daihfesngnfiapeyaykivkkgdstimkseveygncntrcqtpigainssmpfhnihp
    ltigecpkyvksnklvlatglrnspqretr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kthA (A:)
    gdhicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcsvag
    wllgnpmcdefinvpewsyivekanpandlcypgnfndyeelkhllsrinhfekiqiipk
    nswsdheaslgvsaacpyqgkssffrnvvwlikkdnayptikkgynntnqedllvlwgih
    hpndeaeqtrlyqnpttyisigtstlnqrlvpkiatrskingqsgridffwtilkpndai
    hfesngnfiapeyaykivkkgdstimkseveygncntrcqtpigainssmpfhnihplti
    gecpkyvksnklvlatglrnsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kthB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvrnlyd
    kvrlqlkdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kthB (B:)
    ieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavgre
    fnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvrnlydkvrlqlkdn
    akelgngcfefyhkcdnecmesvrngtydypqyseearlkreeis
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kthC (C:)
    adpgdhicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcs
    vagwllgnpmcdefinvpewsyivekanpandlcypgnfndyeelkhllsrinhfekiqi
    ipknswsdheaslgvsaacpyqgkssffrnvvwlikkdnayptikkgynntnqedllvlw
    gihhpndeaeqtrlyqnpttyisigtstlnqrlvpkiatrskingqsgridffwtilkpn
    daihfesngnfiapeyaykivkkgdstimkseveygncntrcqtpigainssmpfhnihp
    ltigecpkyvksnklvlatglrnspqretr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kthC (C:)
    gdhicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcsvag
    wllgnpmcdefinvpewsyivekanpandlcypgnfndyeelkhllsrinhfekiqiipk
    nswsdheaslgvsaacpyqgkssffrnvvwlikkdnayptikkgynntnqedllvlwgih
    hpndeaeqtrlyqnpttyisigtstlnqrlvpkiatrskingqsgridffwtilkpndai
    hfesngnfiapeyaykivkkgdstimkseveygncntrcqtpigainssmpfhnihplti
    gecpkyvksnklvlatglrns
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4kthD (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvrnlyd
    kvrlqlkdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kthD (D:)
    iagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfea
    vgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvrnlydkvrlq
    lkdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeiss
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4kthE (E:)
    adpgdhicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcs
    vagwllgnpmcdefinvpewsyivekanpandlcypgnfndyeelkhllsrinhfekiqi
    ipknswsdheaslgvsaacpyqgkssffrnvvwlikkdnayptikkgynntnqedllvlw
    gihhpndeaeqtrlyqnpttyisigtstlnqrlvpkiatrskingqsgridffwtilkpn
    daihfesngnfiapeyaykivkkgdstimkseveygncntrcqtpigainssmpfhnihp
    ltigecpkyvksnklvlatglrnspqretr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kthE (E:)
    gdhicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcsvag
    wllgnpmcdefinvpewsyivekanpandlcypgnfndyeelkhllsrinhfekiqiipk
    nswsdheaslgvsaacpyqgkssffrnvvwlikkdnayptikkgynntnqedllvlwgih
    hpndeaeqtrlyqnpttyisigtstlnqrlvpkiatrskingqsgridffwtilkpndai
    hfesngnfiapeyaykivkkgdstimkseveygncntrcqtpigainssmpfhnihplti
    gecpkyvksnklvlatglrns
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4kthF (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvrnlyd
    kvrlqlkdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kthF (F:)
    ieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavgre
    fnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvrnlydkvrlqlkdn
    akelgngcfefyhkcdnecmesvrngtydypqyseearlkree