PDB entry 4ktd

View 4ktd on RCSB PDB site
Description: Fab fragment of HIV vaccine-elicited CD4bs-directed antibody, GE136, from non-human primate
Class: immune system
Keywords: Antibody Affinity, Antibody Specificity, Vaccine Elicited Antibodies, Fab fragment, AIDS Vaccines, IMMUNE SYSTEM
Deposited on 2013-05-20, released 2014-02-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.215
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: GE136 Heavy Chain Fab
    Species: Macaca mulatta [TaxId:9544]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KTD
  • Chain 'L':
    Compound: GE136 Light Chain Fab
    Species: Macaca mulatta [TaxId:9544]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KTD
    Domains in SCOPe 2.03: d4ktdl1, d4ktdl2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4ktdL (L:)
    qpvltqptslsaspgasarlsctlssgftvgrysifwyqqkpgsppryllyyfsdssqhq
    gsgvpsrfsgskdasanaglllisglqsedeadyhcaiwhsgawvfgggtrltvlgqpka
    apsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnk
    yaassylsltpeqwkshrsyscqvthegstvektvaptk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ktdL (L:)
    pvltqptslsaspgasarlsctlssgftvgrysifwyqqkpgsppryllyyfsdssqhqg
    sgvpsrfsgskdasanaglllisglqsedeadyhcaiwhsgawvfgggtrltvlgqpkaa
    psvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnky
    aassylsltpeqwkshrsyscqvthegstvektvap